SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007823 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007823
Domain Number 1 Region: 240-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000027
Family I set domains 0.093
Further Details:      
 
Domain Number 2 Region: 93-144
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 160-234
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000772
Family Pre-dockerin domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000007823
Domain Number - Region: 418-477
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0379
Family Carboxypeptidase regulatory domain 0.067
Further Details:      
 
Domain Number - Region: 9-117
Classification Level Classification E-value
Superfamily Vitelline membrane outer protein-I (VMO-I) 0.0523
Family Vitelline membrane outer protein-I (VMO-I) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007823   Gene: ENSORLG00000006227   Transcript: ENSORLT00000007824
Sequence length 1098
Comment pep:known_by_projection chromosome:MEDAKA1:3:16879559:16883376:1 gene:ENSORLG00000006227 transcript:ENSORLT00000007824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTTWFNVDHPGGRGDYEQLDAIRFYYRSRVCETPRAVEARTTEWIPARETGEIVHADPS
VGFWCLNTEQSPGRNCSNYAVRFLCPKDSSQTTQGTWGPWSNWSPCPALCGQEAMQRRYR
SCRSQLVPCSGPKTEEKPCNGPECINADCDACMCEEHILLGSVRSAGGLIATGAAILRAN
KLLTLTDHNGHFRIPGICPDGNTTLTVNVKGHASLNAVVPSSTERTSVLTIQLKRAEKLH
ILSNPESKARREGQSVAFCCKVAGRPEPDKYQWFHNNTVMEMETDGMLVLRDLHSQQAGE
YYCRASGASGTIKSKPATLKVIGKDERSCNPKPESHLIRLPHDCHQNTTDSFYYDVGKCP
SSQCTGQIDNSIRCKDKLAYCCGVAKMEERQLTCQGYQLPTMVVTECGCKKCVDTKAVVH
GRAIAADNGEPMRFGHIFMNGVRVSRTGYKGTFSIQVPPDTDRFVLTFVDNMQKFVNTTK
VLPFNTKGGAVYHEVKLLRKKNPVTISSLETNTLELGEVKDQEAMVQIQIPPHSFYKENG
EVFTGNVSASVTFLDPRDVSTAAAAQSDLNFIGNEGDTLPLRTYGMFSIDFRAEENNEVL
NAGEVKVFLDSAQVKMSEHLDAMKLWSLNPDTGLWEEEGDLKIERKNRGKREERTFLIGN
MEIRERRLFNLDVPENRRCYVKVRAFRGERFMPSEQVEGVTVSLINMEPTAGYSSNPRAW
GRFDSVITGSNGACLPAFCDEQKPDAYTAFVMANLGGEELEVVPSAPKFNPSLIGVPQPY
LGKLNYRRTDHEDPRVKKTAFSINVAKPSPNTAEEANGPVYTFENLKECEEAPFSAGHFR
FSRVEGDRYDYNTVPFNEDDPMSWTEDYLSWWPKPMEYRACYIKIKINSPHEINVRSRNM
GGTHPKTVGQLYGLRDTRSIRDMDLANVSAVCLEFKCSGMLFDQDRVDRTLVKVIPQGSC
RRDGVNTMLQEYLVNHLPLAVNNDTNEFTMLGPLDPLGHNYGIYTVTDQDPRTAKEIALG
RCFDGTSDGTSRVMKTNEGVALTFTCGDRDGTRQSVFQASRGQIGAVVRGKTRNTRGRHR
ANSSRGIPKRSARNPVRK
Download sequence
Identical sequences H2LP43
8090.ENSORLP00000007823 ENSORLP00000007823 ENSORLP00000007823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]