SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008276 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008276
Domain Number 1 Region: 75-296
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-47
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 285-428
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000056
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 437-473
Classification Level Classification E-value
Superfamily SH3-domain 0.00000775
Family SH3-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008276   Gene: ENSORLG00000006596   Transcript: ENSORLT00000008277
Sequence length 473
Comment pep:known_by_projection chromosome:MEDAKA1:18:14766509:14776410:1 gene:ENSORLG00000006596 transcript:ENSORLT00000008277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGIRRKTEAKAFPSEPLYQTYRASVITKEIRRQTVCRNISKTSADYDWAARPSSNGGGP
RSSPIPADKSTLWQDLPQVRESGVLETLTPEQCKYQESMFEVLTSETSYLRSLHVLTEHF
LENRELGEALIIRDTKTLFSNILRVREVSERFLKDLEDRVFQDIVFPDICDIIHYHSQHN
FPAYIDXVISVCCDLCVLSSLRKTNAQFAAVIARLQESPQCQRLPFVSFLLLPFQRITRI
KMLIENILKRTKEGTKEEQSASKALESVSKIISECNTEVGKMRQMEELIEVSKTLEFDKL
KAVPIISQNRYLEKRGDLQEMSKGATLFNVRGKFSPVHFFLFNDLLVIAVKKGSERFVVI
DHAHRSLVQAQIMEEGGSSGLPFENCFVLTLLENHQGRMNERLIKAPSQSDMHRWLAAFP
SSTTADGDEDEVVYEDWDCPQVQCVEQYVAQQADELSLEPAEIINVIRKANEG
Download sequence
Identical sequences H2LQD6
ENSORLP00000008276 8090.ENSORLP00000008276 ENSORLP00000008276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]