SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008277 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008277
Domain Number 1 Region: 45-496
Classification Level Classification E-value
Superfamily Sema domain 4.45e-138
Family Sema domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 848-900
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000209
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 3 Region: 602-652
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000719
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 790-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000419
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 656-708
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000122
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 6 Region: 492-542
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000968
Family Plexin repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 904-949
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008277
Domain Number - Region: 546-599
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00262
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008277   Gene: ENSORLG00000006593   Transcript: ENSORLT00000008278
Sequence length 1091
Comment pep:known_by_projection chromosome:MEDAKA1:2:30990467:30999136:-1 gene:ENSORLG00000006593 transcript:ENSORLT00000008278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMVTSGRGVWTLSPCLVLALLVCRSEQTEVKPACCSSEEHPIASYQALRPWMWEFSHPEA
KDFSQLAVDLSGKQLIVGARNALFRLTLNNVSLIQASEWAPDEDTRRSCQSKGKSQDECQ
NYIRVLLVSGAWLLTCGTNAFTPVCMTRQMSNISKVLETVNGVARCPYDPRHNSTAMVTE
RGELYAATVIDFSGRDPVIYRSLGNMPPLRTAQYNSKWLNEPHFVSSYGIGPFAYFFLRE
SAVENDCGKMVFSRVARVCKNDMGGRFLLEDTWTTFMKARLNCSRSGEIPFYYNELQSTF
HLPEQDLIYGVFTTNVNSLSASAVCAFNLSAITLAFNGAFRYQENPRTAWLSTPNPIPNF
QCGTLEEDGPGGNLTERSLQDAQRLFLMNDVVQPATINPLLTQDNVRFSRLVVDIVQGKD
ALYHVMYIATEYGTILKALATTNKRLHGCYLEELRIQPQGHTGPIKSLHLLHSDRSLFVG
LDDRLLKIPLERCSSYLTERHCLDTRDPYCGWDHKQKRCCTFEESSNMNQWTQNITECPV
RNLTQDGGFGPWAPWQPCNQDEGDGFFSSCWCRSRSCDEPVAKCGGLECKGPTIQVANCS
RNGGWTPWSSWGHCSSSCGIGFEVRQRSCNNPAPRHGGRICVGQGREERLCNEKTPCPLP
VSWTSWSSWTHCSAECGGGVHSRTRTCENGAVCPGCATEFKVCNLEACPDVRRNTPWTPW
MPVNVSHDGSRQEQRFRYTCRALLADPQQLQLGKKKLETRFCPNDGSGACQSEPLVEDLL
KSSGRTLSHPQNAKWGSWEMWSGCSHPCSGGFRTRKRSCSTAEGRTNPAACVGSPVDYQD
CNTQPCKVGGAWTCWSSWSQCSSSCGGGYYQRARTCSNPPPANGGDICIGLHTEEALCNT
HACEAGWGEWANWGECDDDGLQHRARRCGEQQQAELRLCQGNLTQSRPCRPHEVPVILPG
QEEQSCGAFTLFQLVAVGSASFFAAALLSALVYSYCHHLNRPSAESAVIHPSTPNHLTYN
KQGNAAPKNDKYIPMEFKMLNKNNLHVNDETCNHFPPPLSSTNMFSTTYYPPCVSKYDFH
PDSPCRTFLHS
Download sequence
Identical sequences H2LQD7
8090.ENSORLP00000008277 ENSORLP00000008277 ENSORLP00000008277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]