SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008278 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008278
Domain Number 1 Region: 39-490
Classification Level Classification E-value
Superfamily Sema domain 3.01e-138
Family Sema domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 596-646
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000536
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 784-840
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000301
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 650-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 5 Region: 486-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000706
Family Plexin repeat 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008278
Domain Number - Region: 540-593
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00196
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008278   Gene: ENSORLG00000006593   Transcript: ENSORLT00000008279
Sequence length 847
Comment pep:known_by_projection chromosome:MEDAKA1:2:30991650:30999118:-1 gene:ENSORLG00000006593 transcript:ENSORLT00000008279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGVWTLSPCLVLALLVCRSEQTEVKPACCSSEEHPIASYQALRPWMWEFSHPEAKDFSQL
AVDLSGKQLIVGARNALFRLTLNNVSLIQASEWAPDEDTRRSCQSKGKSQDECQNYIRVL
LVSGAWLLTCGTNAFTPVCMTRQMSNISKVLETVNGVARCPYDPRHNSTAMVTERGELYA
ATVIDFSGRDPVIYRSLGNMPPLRTAQYNSKWLNEPHFVSSYGIGPFAYFFLRESAVEND
CGKMVFSRVARVCKNDMGGRFLLEDTWTTFMKARLNCSRSGEIPFYYNELQSTFHLPEQD
LIYGVFTTNVNSLSASAVCAFNLSAITLAFNGAFRYQENPRTAWLSTPNPIPNFQCGTLE
EDGPGGNLTERSLQDAQRLFLMNDVVQPATINPLLTQDNVRFSRLVVDIVQGKDALYHVM
YIATEYGTILKALATTNKRLHGCYLEELRIQPQGHTGPIKSLHLLHSDRSLFVGLDDRLL
KIPLERCSSYLTERHCLDTRDPYCGWDHKQKRCCTFEESSNMNQWTQNITECPVRNLTQD
GGFGPWAPWQPCNQDEGDGFFSSCWCRSRSCDEPVAKCGGLECKGPTIQVANCSRNGGWT
PWSSWGHCSSSCGIGFEVRQRSCNNPAPRHGGRICVGQGREERLCNEKTPCPLPVSWTSW
SSWTHCSAECGGGVHSRTRTCENGAVCPGCATEFKVCNLEACPDVRRNTPWTPWMPVNVS
HDGSRQEQRFRYTCRALLADPQQLQLGKKKLETRFCPNDGSGACQSEPLVEDLLKSSGRT
LSHPQNAKWGSWEMWSGCSHPCSGGFRTRKRSCSTAEGRTNPAACVGSPVDYQDCNTQPC
KGEPDPE
Download sequence
Identical sequences H2LQD8
ENSORLP00000008278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]