SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008529 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008529
Domain Number 1 Region: 22-110
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-26
Family Kringle modules 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008529   Gene: ENSORLG00000006788   Transcript: ENSORLT00000008530
Sequence length 273
Comment pep:known_by_projection chromosome:MEDAKA1:9:12304903:12310489:1 gene:ENSORLG00000006788 transcript:ENSORLT00000008530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAAWSRTLVSAGVVGSSASAQTDCVRSDGLDYRGKQQSSSSGLACLNWINITRDYDAEI
HPDSQTGAGDHNYCRNPDASERPWCYIAGPDGTIQRQFCTIETCKVKMYLTAESAEQTSA
APVETASSAPTGSTASEESFQPARSRISQAEVAAVQPVMGISQRVHTGPRKKKDLGTTGY
VLAILMMAIIIILGVGITLGYFYKRGRDLKKQHDQRVYEREMQRITLPLSAFYNPTCELI
DENTIVITAEPETTPVQEGEDPLMGQHAGTPGA
Download sequence
Identical sequences H2LR32
8090.ENSORLP00000008529 ENSORLP00000008529 ENSORLP00000008529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]