SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008631 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008631
Domain Number 1 Region: 455-587
Classification Level Classification E-value
Superfamily TIMP-like 1.54e-25
Family Netrin-like domain (NTR/C345C module) 0.032
Further Details:      
 
Domain Number 2 Region: 264-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 3 Region: 320-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 4 Region: 383-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000008631
Domain Number - Region: 25-164
Classification Level Classification E-value
Superfamily Sialidases 0.0167
Family Sialidases (neuraminidases) 0.044
Further Details:      
 
Domain Number - Region: 67-105
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0349
Family Family 19 glycosidase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008631   Gene: ENSORLG00000006869   Transcript: ENSORLT00000008632
Sequence length 589
Comment pep:known_by_projection chromosome:MEDAKA1:18:15096001:15109220:-1 gene:ENSORLG00000006869 transcript:ENSORLT00000008632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILLRLFILILPLTPTSSSFSHTPLSWTSPHDPCYNPDGRPRHCLSEFINAAYGVPVNASN
SLCVHNTDGNITTLTDLHNPNNITCWMAHAGHETGDWVLTLPLGRRFEITYISLQFCNQE
EPPDPISLSIFKSMDYGRSWRPMQRYSSDCVVHFQQPTQTIAQTRHQETDALCSDPRPFQ
RQRGGAVLAFSALDGRPSSPDFDYSPTLQDWVTATDIRIVFHHISQNLKKGGKVRGGAHK
KEDKQWGSCPIGGSISDLQVGGRCKCNGHASRCRRDDTGRAVCVCEHHTAGPDCDVCADF
YVDRPWHRATPTHPNPCVACDCNGHSNKCRFSMEVFLQSGRKSGGVCQKCRHNTAGRHCQ
YCQNGYARDHTKALSHRKACQPCQCHPVGAVGRWCNQTSGQCLCRDGVTGLRCNRCAPGY
KQGKSPLRPCIRIQEAAPTPVYQPQYSIAEECVSYCQPTQAEVRMNLETYCLKDYVLKVQ
VKGMERSGPWWQFSITVQVVFRTRSASRIRRGPQSLWVPNRDLTCGCPALHVGRTFLLIG
AEEGERGWGPEESRLVADRSTLALQWREHWSPKLRAFRGQDKRGRCPSK
Download sequence
Identical sequences H2LRD2
8090.ENSORLP00000008631 ENSORLP00000008631 ENSORLP00000008631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]