SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008693 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008693
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 2 Region: 128-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 3 Region: 270-394
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-30
Family Netrin-like domain (NTR/C345C module) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008693   Gene: ENSORLG00000006921   Transcript: ENSORLT00000008694
Sequence length 394
Comment pep:known_by_projection chromosome:MEDAKA1:18:15170752:15184617:-1 gene:ENSORLG00000006921 transcript:ENSORLT00000008694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPLFPCGGHMVTDSGMVASEGFPSFYKPNSKCTWYITVPEGHVVMLSFRLFDLEADPTCR
YDYLDVYNGHSRLVQKLGRFCGTFRPGALISTSNTMMLEMVSDDATGGRGFLASFNAGKP
HMEENQFCGGRLTKAQGSVKTPNWPNSNYPAGISCSWHISVEPSNVIEVKFEKMDLEADT
YCRYDYVALFNGGERDDSRRIGKFCGDRQPGTIVTNGNELLVQFVSDLSVTSDGFLAYYT
RKPTKKPTVRPKVIKTTAKPSTMPTSTPLPLNPICTQPCKRTGTLQSNFCPHSFVITGKV
TSVNNGPRGSATIEVSLIKAYKTGQLKITKSGPVKTVVLTSTCKRCPGIVKGRNYVLMGN
VDERGNGLLSPSSFTLLYKPVHAKPLDMLSKTAC
Download sequence
Identical sequences H2LRJ4
ENSORLP00000008693 8090.ENSORLP00000008693 ENSORLP00000008693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]