SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008718 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008718
Domain Number 1 Region: 630-943
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 6.75e-73
Family Complement components 0.00000287
Further Details:      
 
Domain Number 2 Region: 1060-1205
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.19e-39
Family Alpha-macroglobulin receptor domain 0.00075
Further Details:      
 
Domain Number 3 Region: 1204-1360
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-38
Family Netrin-like domain (NTR/C345C module) 0.00049
Further Details:      
 
Domain Number 4 Region: 310-381
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.0000000000000222
Family Anaphylotoxins (complement system) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008718   Gene: ENSORLG00000006939   Transcript: ENSORLT00000008719
Sequence length 1362
Comment pep:known chromosome:MEDAKA1:16:12518724:12541054:-1 gene:ENSORLG00000006939 transcript:ENSORLT00000008719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEIQEAKVYLPVFSKKYIVDFSRTRSHFVYGYPLDVVVDVSFPDGSPAPNVPVKIEVGDG
ESMELPTDKDGTVIAPFNLKNLEQVTFEVTADGQLENKTIQRASQRDNYLYMTYTNKVYY
VGEHFKVTFNTLNAAGDGNIYYMILSRGNIISTGVVPLGVSVSKVLQITAAMVPFFRLVG
YYHSKNGNIIADSIWVDVKDECEIDVKVQTQEETRPGTITKLQFDLHGQTAQVALLAVDK
AIYALKADNKLTAQQVFKTMESHDLGCTYIKKPESKLIEAGLAFFSQSEKEWRTEIKCPS
KIGRSRRSIDLQQEMNRLKSGYEDTELQLCCAQAFSLIPMKRTCRERAARVRLVGGSEAC
AAAFEKCCTETEILRRRKILEEGQSGFGRSATTNDIEEFFKDSTNQYIRRYFPPSFAFTD
FEVNKEGRYDLALPDSITTWEIQVVTFSPTSGLCVVKPQEIKAFKKSFVSLRLPYSVKRY
EQLSVTPVIYNYDDKELKVAVHMEQTEGLCSPASATQSSFVTTVVKPHSSQFVSFSAVPM
VTGSIPIKIRLFDNETEMGIDAQQKNLLVKTEGAENRLEETQVIHLDGNSTRTLTIIGTL
PDNTVPESSSNIFISMEANGFCTSQVSNLLNPEKVSNLIHLYKGCLEQTMSTFAPTTLAM
RYLDLSQQWFTLEPGARDVALSEMEQGYLRILTFKNKATGAYGAWSSVPYSTWVTALVVK
MLSLVTERQSTAVGPSSQRLKVVPQDEISQSVKFLLSSQKTDGTFGDPHPMIHRDSMTGT
NKDVAMTAFITLALNRSLPFLPDELQTNVKTSISKAIEYLQLQLENITHPYAMAITSYCL
STCPSEERNRTAAWKKLQLMVKEARNDRYFWSDDPNMANQERADGVTIQTTAYALLTAVQ
VKNGEWADKIAHWLISQENYNGGFLSTHDTILALEALSEYELKKGECPEANVEAEFSVTG
KNQVVQLSMKNNKEKVETEMKSLTGNIITVQLKGKGDIKFKTVKAFHMLDPEDDCTDVSI
SVTVEGKVEYTAEILENYDYGDYEETDKDGSRVSRSADNWFDSHTRSRRDLENDVNAANL
LTYEVCVRHSSTRNLTGMAIADITLLSGFEAKKEDLEKLKRPPEQYITHYELINGKVVIY
FNELFEKKECIKFDAEQFVPVGLLQPAEAVFYDYYEPERKCRIFYSAPRRNRMIFTLCSE
DVCQCAERPCYKVKERFKSHGSKKIKKIDRVEHACFYPVVDYAYIVTVNSVSLKSNFELY
KANIANVLKSSGDLLVKKENSVRVFAKRLQCKGQLEVGNQYLIMGKDGSTTDTDGKMQYL
LESDTWVEKMPSAEDCKKSFNKNNCKQLNEFIEEYKMNGCTQ
Download sequence
Identical sequences H2LRL9
ENSORLP00000008718 8090.ENSORLP00000008718 ENSORLP00000008718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]