SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008743 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008743
Domain Number 1 Region: 543-857
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.89e-67
Family Complement components 0.00000442
Further Details:      
 
Domain Number 2 Region: 974-1119
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.92e-39
Family Alpha-macroglobulin receptor domain 0.0007
Further Details:      
 
Domain Number 3 Region: 1118-1274
Classification Level Classification E-value
Superfamily TIMP-like 5.49e-38
Family Netrin-like domain (NTR/C345C module) 0.00056
Further Details:      
 
Domain Number 4 Region: 222-291
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 0.00000000000000314
Family Anaphylotoxins (complement system) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008743   Gene: ENSORLG00000006961   Transcript: ENSORLT00000008744
Sequence length 1276
Comment pep:known_by_projection chromosome:MEDAKA1:16:12570395:12586677:-1 gene:ENSORLG00000006961 transcript:ENSORLT00000008744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLENKIIHRSSRRDNYLYITYTNKVYYVREHFKVTFNTLNAAVDGNIYYMILSRGNIIS
TGVVPLGVSVPTILQITAAMVPFRLVGYYYNENGDIIADSILVNVKDECEIDVKVQTEQQ
TMPGTITYLDFDLHGQTAQVALLSVDKAIYALNADNKLTAQQVFATMESHDLGCTYGGGK
DSKSILDEAGLAFFSQSMEEWRIINPETDCRLQTGRSRRSIDLQQEMNTLKSGYKDPELQ
SCCAQAFSLIPMKRTCRERAARVRLVGGSEACAAAFEKCCKETEILRRRKILGEGQSGFG
RSATNNDIEEFFKDSTNQYIRRYFPPSFAFTDFEVNNKKRYDLALPDSITTWEIQVVTFS
PTSGLCVVKPQEIKAFKRSFVSLRLPYSVKRYEQLSVTPVIYNYHDKELKVAVHMEQTEG
LCSPASATQGSFVTTVVKPHSSQSVSFSAVPMVTGSIPIKIRLFDIDSELGIDAQQKSLL
VKTEGAENRQEETQVIHLDGNSTRTLYINGTLPDNTVPESSSNIFISMEGNGFCTSQVSN
LLNPEKVSKRIGLYLGCLEQTMSALAPTVLAMRYLDLSQQWFTLKPGARDVALSHIEQGY
MRILTFKNERTGSYSPWEYAPYSTWVTALVVKMLSLITERQSTAVGPNSQLLKVVPQKEI
TEPVEFLLSLQNSDGTFDDQHLMIHRYTLTETNQDIAITAFITLALNRSLQFLSDELQTN
VKTNISKAIEYLQLQLENITHPYAMAITSYCLSTCPSEERNHMAAWEKLQSMVKEGLAAN
DGYFWSDDPNMANKKRANGITIQTTAYALLTAVKVENREWADKIAHWLIRQENYNGGFRA
THDTILALEALSEYELKKSECPEANIEAEFSVTGKNQVVQLTMKDNKEKVETEMKSLTGN
IITVQLKGIGDIKFKTVKAFHMLDPEDDCTDVSISVTVEGKVEYTAEILENYDYGDYEET
EKDSARVSRSVDNWFDSHTRGRRDHENDLNAAKVVTYKVCVSHSSTRNLTGMSIADITLL
SGFEAKKEDLEKLKRPPEQYITHYELINGKVVIYFNELFEKKECIAFDAEQLVPVGLLQP
AEAVFYDYYEPERKCRTFYSAPKRNRMISKICSEDVCQCAERPCYKVKERFKSHGSKKIK
KIDRVEHACFYPVVDYAYIVTVNSVSLKSNFELYKANIANVLKSSGDLLVKKENSVRVFA
KRLQCKGQLEVGNQYLIMGKDGSTTDTDGKMQYLLESDTWVEKMPSAEDCQKSFNKNNCK
QFKEFIEEYKINGCTQ
Download sequence
Identical sequences H2LRP2
8090.ENSORLP00000008743 ENSORLP00000008743 ENSORLP00000008743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]