SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008757 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008757
Domain Number 1 Region: 261-325
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000262
Family VWC domain 0.0086
Further Details:      
 
Domain Number 2 Region: 115-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000366
Family VWC domain 0.03
Further Details:      
 
Domain Number 3 Region: 36-102
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000654
Family VWC domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008757   Gene: ENSORLG00000006973   Transcript: ENSORLT00000008758
Sequence length 455
Comment pep:known_by_projection chromosome:MEDAKA1:14:14812265:14820509:-1 gene:ENSORLG00000006973 transcript:ENSORLT00000008758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVVWKRNNMKSTFLVLFIIWSAAGELRPRKGSGVVCTFKDKTYSYGDSWHPNLEPFGF
MFCVRCVCAETGHVKCSTLKCPALSCEHPVTEPQRCCPRCTDEPRVPAGLRASVKSCRYN
GSIYQSGETFSKHDLFPSRQSNQCVMCTCSNGNIFCALKTCQPVTCSSPVSLTDTCCLVC
KDHGAGGSSSTEDGSLQLNRGVRHSVDQCPGEQSRLRLDRAPAPRVKTPPRGLSLSKLNL
KGASETTVKILMQRKHQKVLLVCLYNGKTYSHGDMWHPVLGKVLECILCTCIDGLQDCKR
ITCPSQYPCRHPIKSAGKCCKTCPESKTESNQTQCHVGYKTKLLVYRVESSPKADSHNTV
RIIAVERQSTAEVEVQVWNTVEGILQMMEIGDVQRKDITDHPENYTLLTMLDEEMWKKFK
DVGENLSKAPQTTICEDGIREILTFLNPKQTEGLC
Download sequence
Identical sequences H2LRQ5
ENSORLP00000008757 8090.ENSORLP00000008757 ENSORLP00000008757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]