SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000008995 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000008995
Domain Number 1 Region: 481-630
Classification Level Classification E-value
Superfamily TIMP-like 9.94e-35
Family Netrin-like domain (NTR/C345C module) 0.041
Further Details:      
 
Domain Number 2 Region: 299-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000352
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 355-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 4 Region: 418-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 103-177
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000741
Family Galactose-binding domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000008995   Gene: ENSORLG00000007171   Transcript: ENSORLT00000008996
Sequence length 633
Comment pep:known_by_projection chromosome:MEDAKA1:19:7692275:7722229:1 gene:ENSORLG00000007171 transcript:ENSORLT00000008996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRMRVPWRCLLGLFLLVKSVSPHSPTSPFAGQQTPLDPCYDETGTARRCIPEFINAAFG
KEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTC
WQSENLNTSPHNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSS
QCRRMYNKPNKATITKQNEQEALCTDGHTDLYPLSGGLIAFSTLDGRPSSKDFDNSPVLQ
DWVTVTDIRVVFGRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCK
CNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLH
ARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDC
HPVGAAGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSST
EEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYKSRGE
PLKRGDNILWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLV
ADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSKA
Download sequence
Identical sequences H2LSD4
8090.ENSORLP00000008995 ENSORLP00000008995 ENSORLP00000008995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]