SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009143 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000009143
Domain Number - Region: 169-218
Classification Level Classification E-value
Superfamily TIMP-like 0.000235
Family Tissue inhibitor of metalloproteinases, TIMP 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009143   Gene: ENSORLG00000007292   Transcript: ENSORLT00000009144
Sequence length 291
Comment pep:known_by_projection chromosome:MEDAKA1:8:9798997:9804370:1 gene:ENSORLG00000007292 transcript:ENSORLT00000009144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLLPLLLLFRISFCQYSSDQCSWKGSGLTHEGHTRDVEQVYLRCSQGSLEWLYPTGA
IIVNLRPNVVSPAAARLSVCIKPLTNSSGTNLFLDLNGKLRLLLSEQGQAQGKVHCFGIQ
EGALFIEAVPRLDISRRITAFQYELVSDRLGDAQKPGGCHSLKITPPPPCQPCSDDQMHL
AVCTSDFVARGTIKKVNQEEEHSSLSVEISRLYRQKTQIFVSGGVRVRNWTGLIKMPRHC
GAKVGEGEFLFMGMVRFGEAWMSCAPRYKDFMRMYQEAQQLGTNLCQVDTD
Download sequence
Identical sequences H2LSS7
ENSORLP00000009143 8090.ENSORLP00000009143 ENSORLP00000009143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]