SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009149 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000009149
Domain Number - Region: 165-214
Classification Level Classification E-value
Superfamily TIMP-like 0.000377
Family Tissue inhibitor of metalloproteinases, TIMP 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009149   Gene: ENSORLG00000007292   Transcript: ENSORLT00000009150
Sequence length 287
Comment pep:known_by_projection chromosome:MEDAKA1:8:9799226:9804428:1 gene:ENSORLG00000007292 transcript:ENSORLT00000009150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMRAPLLPLLLLFRISFCQYSSDQCSWKGSGLTHEGHTRDVEQVYLRCSQGSLEWLYPTG
AIIVNLRPNVVSPAAARLSVCIKPLTNSSGTNLFLDLNGKLRLLLSEQGQAQGKVHCFGI
QEGALFIEAVPRLDISRRITAFQYELVSDRLGDAQKPGAFGLKPPCQPCSDDQMHLAVCT
SDFVARGTIKKVNQEEEHSSLSVEISRLYRQKTQIFVSGGVRVRNWTGLIKMPRHCGAKV
GEGEFLFMGMVRFGEAWMSCAPRYKDFMRMYQEAQQLGTNLCQVDTD
Download sequence
Identical sequences H2LST3
ENSORLP00000009149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]