SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009248 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000009248
Domain Number - Region: 184-272
Classification Level Classification E-value
Superfamily TIMP-like 0.0011
Family Tissue inhibitor of metalloproteinases, TIMP 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009248   Gene: ENSORLG00000007379   Transcript: ENSORLT00000009249
Sequence length 302
Comment pep:known_by_projection chromosome:MEDAKA1:19:7936403:7941561:1 gene:ENSORLG00000007379 transcript:ENSORLT00000009249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLISTLLCDICRGGLASNHSFANYSEDQCSWRGSGLSQQKGSVEQISLHCSEGTLNWLYP
KGALHLTLSPRLPSVAVGPGGSSSGLITTCVKPSEQFHGAQLYLEKDGVLELLVGDRLES
SPPPRVRCFSRLPGEKVALFMQATPHQDISRRIASFRYELRGDWSARMSLDSNSISSEDA
CRPCNNTEILMAVCTSDFVVRGNIRSVEEDESLRAAVIKVKSTRVFRQKYTIFNSNSRLP
SWGEVRTLLQCGVKPGPGSFLFTGRIHFGEAWLGCAPRYRDFQRTYALAKAAQQIPCELP
VD
Download sequence
Identical sequences H2LT30
ENSORLP00000009248 ENSORLP00000009248 8090.ENSORLP00000009248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]