SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009463 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009463
Domain Number 1 Region: 58-413
Classification Level Classification E-value
Superfamily L domain-like 3.16e-58
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 2 Region: 553-649
Classification Level Classification E-value
Superfamily Immunoglobulin 8.6e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 640-735
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 451-557
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-19
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009463   Gene: ENSORLG00000007549   Transcript: ENSORLT00000009464
Sequence length 913
Comment pep:known_by_projection chromosome:MEDAKA1:5:14081690:14094593:1 gene:ENSORLG00000007549 transcript:ENSORLT00000009464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGYSSCPAPCSCSKRQDDLEIVDCNRKKLLVPPQDLPERTTHVNVVISTNCCFEINTMNH
NELTVFPFLGEGSSNITSLSLVHNKIMEVSMYLLQPYVSLESLDLTSNSISELTVGSFPS
IQLKYLNLTNNKISVLEPGCFENISSSLLVLRLNRNRIAVLPSKVFRLPQLQVLEMKRNR
IKFVDSLTFKGMDSLRSLKMQRNGISKLMDGAFFGLTNIEELELEHNNLTEIDKGWLYGL
RMLRVLQISHNAVGVIRPDAWEFCQKLELLDLSSNHLTRLEETAFIGLGLLENLYLGENA
ISHLGEGVFSGLTNLRTLDIHNNEISWAIEDSIGLFDGMKKLSNLILQQNKIKSITEKAF
EGLKELEYLDLSKNDIMSLHPQAFSQLKLKGFVLNTSSLLCDCHMQWLGPWLSESPFLQS
VSAVCAHPADLFGRKVLSISPEEFVCEDFPKPQIKTHPETSVVLRGSNVTLRCVASSSSD
SPMTTAWRKDGEVLYDAEVQNYARYQEGELIYTTVLHLLNVNFTDEGRYQCVVSNHFGSN
YSNRAKLTVNEMPSFLKTPMDLTIRTGTMARLECAAEGHPSPQIAWQKDGGTDFPAARER
RMHVMPDDDIFFIANVKTEDMGVYSCTAQNAAGSLSTNATLTVLETPSFVRPLEDRTVAR
GETAVLQCIAGGSPTPRLNWTKDDGPLVLTERHFFAAANQLLIIVDAGPADAGKYTCIMS
NTLGTERGHIYLSVLPSANCETGAGYDPDGWTTVGIVVIVVVCCVVGTSLVWVIVIYHMR
RKTEDYSITNTDEMNLPADIPSYLSSQGTLSEHQEGYSSSEAGSHQQLMPPLSNGYIHKG
TDGGPGSLVICSDCYDNANIYTRTREYCPYAYVGEDDPLGRATPGLKESLNEHAQQEDAT
LEGLISNHDSSVF
Download sequence
Identical sequences H2LTP4
8090.ENSORLP00000009463 ENSORLP00000009463 ENSORLP00000009463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]