SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009505 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009505
Domain Number 1 Region: 152-363
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.69e-53
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 450-506
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000183
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 820-876
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000837
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 769-816
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009505   Gene: ENSORLG00000007584   Transcript: ENSORLT00000009506
Sequence length 876
Comment pep:known_by_projection chromosome:MEDAKA1:14:15525622:15537215:1 gene:ENSORLG00000007584 transcript:ENSORLT00000009506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIKIRAFQQELMINLNQDSHFIGPSSIDASWLPNTKSRADLSRCFYSGYVNDDPYSYAAL
SICKGLHGAFDFQGWEYFINPARNDTKSAEEAHIIQRRTSNNLRNSSASRCAVKSDLSHQ
EVQSLIKFKRLADHSNLTESMLKRRAKRFASIPRYVETLVVADASMAQFHGDDLKHYLLT
LMSVAAQLYKHPSILNSISIVVVKIMILSEEDKGPKVSSNAALTLRNFCTWQKKMNKNND
KHPDYWDTAILFTRQDLCGASTCDTLGLADVGTMCDPKRSCSVIEDDGLPSAFTAAHELE
GHVFNMPHDNVRACEDVFGKLQDNHMMSPTLVKMNRTSPWSPCSAAIITEFLDSGHGECL
LDQPQKQLVLPDGLPGASYDLNRQCELAFGEDSKPCIAMQPCSRLWCTGTSSSHLVCMTR
HFPWADGTECGDGKVCDRGVCSEKPAKKMTVDGRWGSWSLFGSCSRSCGGGIQLSKRECT
NPAPSNGGKYCRGLRVKYRSCNLNSCTDAVTEKTFREEQCETSGRNFNSNHVSQSVVWVP
KYSGVSLGDRCKLVCRANGTGYFYVLAPKVIDGTPCSPDSTGVCVQGKCIKAGCDGKIGS
NKKFDKCGICGGDNKGCKKVSGLFTKPVHGYNFVVMLPEGAANIDIRQRGYKGMRGDENY
LAVKNSKGRYLLNGNYVVSAGEKDILVKHTLLRYSGTSGLSETLQTVKPLGESLTVEVLC
AGKMTPPRIRYSFYLPRQTKDHKTLTKHPSGHNSVLDQNSYIEESTAGKWVPTSWEKCSV
TCGDGVQKRSVQCLGPDGKPGLDCDPLQIPSETKVCGDVCSEWHVGQWSPCSRTCGKGFK
RRPLLCKSQTGKLLARDHCTGIRKPQELDFCNLKPC
Download sequence
Identical sequences H2LTT5
ENSORLP00000009505 8090.ENSORLP00000009505 ENSORLP00000009505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]