SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009526 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000009526
Domain Number - Region: 212-252
Classification Level Classification E-value
Superfamily FnI-like domain 0.0764
Family VWC domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009526   Gene: ENSORLG00000007599   Transcript: ENSORLT00000009527
Sequence length 458
Comment pep:known_by_projection chromosome:MEDAKA1:8:10249955:10251367:-1 gene:ENSORLG00000007599 transcript:ENSORLT00000009527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQAPGVLLLFCLGATNALYKQWIPDTNYENKTNWDKGKVPCGNDIALFSAQRKVSVFVE
TTHAVQEMRLPVDGELILNSGAGFYVLGGKDPACGSGTTTEFQDSESLQWFNPALWQAAA
SQNDLQLGNFLFAVHEESVPCQQDDVVFKALSSFRVDTSSSQPTIPVKSVSVLGKTFDSR
AEFSQYLSSRSGQMQFHGSSAVTAGNPGCGDSSGCDCGNSVNHQLICSTVKCATVSCKKP
LSPVGHCCEVCGAIVTIDYTAGFTVQTYRERIHHLFLILPKYKSIQLGISKVFKSQRLLG
VIPFSTIPEIQVVIVDGEDGKVSEDLAQDLMTDIGSHGSEIGITGSEFQASSGNTSDLSG
SNAGMVAGVVIAVLLMIALIAVGAVLIQKGVVRLFRRNTDVGDLGGTIDHGFDNPMFDQP
NTMSNIPGLYGTDRQSISMTQTGVHFVNPVYDENEIDL
Download sequence
Identical sequences H2LTV5
8090.ENSORLP00000009526 ENSORLP00000009526 ENSORLP00000009526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]