SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009550 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009550
Domain Number 1 Region: 56-168
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.36e-38
Family Frizzled cysteine-rich domain 0.0000654
Further Details:      
 
Domain Number 2 Region: 181-310
Classification Level Classification E-value
Superfamily TIMP-like 9.89e-24
Family Netrin-like domain (NTR/C345C module) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009550   Gene: ENSORLG00000007621   Transcript: ENSORLT00000009551
Sequence length 315
Comment pep:known_by_projection chromosome:MEDAKA1:15:21980710:21995713:-1 gene:ENSORLG00000007621 transcript:ENSORLT00000009551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSPRWALTQSSFGLALGLLLFSLLLLTIVAADEYDYYSWQSDNFHNGRFYTKQPQCVDI
PSDLRLCHNVGYKKMRLPNLLDHETMPEVKQQAGSWVPLLAKRCHADTQVFLCSLFAPVC
LDRPIYPCRSLCEAVRNSCAPVMETYGFPWPDMLTCDKFPIDNDLCIPMQFAGNHATLPP
VPKVCPPCDNELKTDNIMEHYCASDFVLKMKIKEVKKEKADRKLIAAQKKKKVLKQGVLR
KKDLKKLTLYIKNGANCPCSQLDSLGSHFLVMGRKVDQQLLLMSIHKWDKKSKELKFAIK
YMKSHQCPTYHSVFQ
Download sequence
Identical sequences H2LTX7
8090.ENSORLP00000009550 ENSORLP00000009550 ENSORLP00000009550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]