SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009631 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009631
Domain Number 1 Region: 57-526
Classification Level Classification E-value
Superfamily Sema domain 1.09e-124
Family Sema domain 0.0000291
Further Details:      
 
Domain Number 2 Region: 1373-1506,1704-1893
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-48
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 1059-1166
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000107
Family Other IPT/TIG domains 0.067
Further Details:      
 
Domain Number 4 Region: 876-974
Classification Level Classification E-value
Superfamily E set domains 0.000000000000529
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 5 Region: 972-1061
Classification Level Classification E-value
Superfamily E set domains 0.000000000000713
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number 6 Region: 529-580
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 7 Region: 825-859
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000275
Family Plexin repeat 0.003
Further Details:      
 
Domain Number 8 Region: 1167-1247
Classification Level Classification E-value
Superfamily E set domains 0.0000125
Family E-set domains of sugar-utilizing enzymes 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009631   Gene: ENSORLG00000007687   Transcript: ENSORLT00000009632
Sequence length 1923
Comment pep:known_by_projection chromosome:MEDAKA1:5:14296197:14359435:-1 gene:ENSORLG00000007687 transcript:ENSORLT00000009632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTEENILLMRAPAKKQQRRQWNRKLRIQPSSALTLRLLTLISANQKTALGQTMNSFQSE
RREWPLNHVTVHQSTGDLYVGAVNRIFKLSANLTLLVSHDTGPEYDNKACYPPLIVQPCS
EPLASTDNVNKLLLIDYSNNRLLACGSLYQGICKLMRLDDLFILVEPTHKKEHYLSSDNQ
TGTMYGVVVPSLGQDATLYIGTAVGGKQDYFPTISSRKLPRDPESSAMLDYELHTDFVSS
LIKIPSDTLALVPHFDIYYIYGFSSGSFVYFMTVQPETPENGMSGGGSPGDLFYTSRIIR
LCKDDKKFHSYVSLPVGCIHRGEEYRLLQAAYLSKVGRVLAKSLNISAQEDVLFAVFSKG
QKQYHDPSDHSALCIFTIQDINARIKERLQSCYQGEGNLELHWLLGKDVQCTKAPVPIDD
HFCGLDINQPLGGSQLVSGRTVFTESRDRLTSVTSYIYNGHSVVFLGSRSGRIKKVSVTN
ALEGGVLYETVIVMKDTGSILRDMAFSLDRSSLYVMSKNQVVQVPVESCEQYGTCAECLS
SGDPHCGWCVLHNMCSRRDRCPRMDESFRFATDIDRCVKVISHPDSIAVSAHSVPLLLEV
NNVPDLSAGITCSFGQQTQADGHVKGNRVMCLSPAGKEVPRIPEGQDWAGVELRLNSKET
GQMVASTEVKFYNCSTHQMCLSCVNSTFRCHWCKYRNLCTHDPSSCSFQEGRVNGSEDCP
QLLNSGEILIPAGEVRPITLRARNLPQPQSGQRGYECVVNVQGASHRVTALRFNSTSVQC
QNSSYMYESVKISDLAVDLSIIWNGNFIIDNPEKIKVHLYKCSAQRDSCGMCLRAEKKFQ
CGWCSGEGRCTMKQHCPPISPYASRWLDLSSRNVKCTNPRITEVSPVAGPVEGGTLVTIK
GLNLGLSFSELEGNVEVAGVQCTPKEEGYITAEQIVCEMTVAPDGSVPGPVKLCIDECKP
ELQALSTQLYSFVSPTMVALIPGRGPESGGTKVTIVGESLDAGSNINILFGNQTCELFKR
TNLEIVCFSGPSVTGAGPVQVSLTVDRARVPGSLSFEYIEDPTVQRIEPLWSITSLISGH
TILTVTGTNLDVVQEPRVRVKYAGQESVNVCKVLNTTTISCFAPSLKADYTNDQESIKHV
DEFGFVFNNVQALLTFNNTGFIYYPNPYLEPLSLTGVLEQKPGAPIILKGRNLVPSASGG
ARLNYSVLIGDAPCSLTVSDTQLLCEPPNLTGQHKILVQVGGLHISPGEVHIRSDSLLTL
PAISSITAGGGLLLIVVIIVLLAYRRKSHENDLTLKRLQMQMDNLESRVALECKEAFAEL
QTDINELTSDLDRAGIPFLDYRTFAMRVLFPGIDDHPVLRELEVPGSGQANVEKALKQFA
QLVNNKVFLLTFIRTLELQRSFSMRDRGYVASLIMTALQSRLEYATDILKHLLSDLIERN
LESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKKTKECAGEPLFMLFCAIKQQMEKGP
IDAVTGEARYSLSEDKLIRQQIEYKTLTLSCVNPDNENSPEIPVKVLNCDTITQVKEKIL
DAVYKNMPYSLRPRAADMDLEWRQGRTARVVLQDEDITTKIEGDWKRLNTLMHYQVSERC
VVALVPKQMSSFIIPSSASFPRSVSRYGVDVPFRSTPTSPDSPHSRVPMLTPDLESGVKV
WHLVKNHDHGDQKEGERGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVCRGTALPL
AIKYMFDFLDEQADRHGIHDVDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACL
SVVAQTFMDSCSTSEHRLGKDSPSTKLLYAKDIPHYKSWVERYYADINRLPAISDQDMNA
YLAEQARLHSSEFNVLSALHEIYTYVSKYSQEIIEALEQDEQAQKQKLAYKVEQITLVMS
TES
Download sequence
Identical sequences H2LU57
ENSORLP00000009631 ENSORLP00000009631 8090.ENSORLP00000009631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]