SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009632 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009632
Domain Number 1 Region: 24-164
Classification Level Classification E-value
Superfamily TIMP-like 9.42e-51
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009632   Gene: ENSORLG00000007689   Transcript: ENSORLT00000009633
Sequence length 211
Comment pep:known chromosome:MEDAKA1:8:10346030:10499693:-1 gene:ENSORLG00000007689 transcript:ENSORLT00000009633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSCLVTLAVLLLWRVEEIAEACSCSPAHPQQAVCNSDVVIRAKLVGRQEVDAGNDIYG
NTIKRIKYDVKQIKMFKGPSHDIDAVYTAPSSSLCGVSMDTTGKKEYLITGKLETDGTMH
VTLCDFIDQWDAMTATQKKNLIQRYESSCDCKVERIQVLTVHVKVLTSKENGSVCCAHLL
KFRLWLLVELLTVSLSEGRLMGACSRLEPFL
Download sequence
Identical sequences H2LU58
ENSORLP00000009632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]