SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009634 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009634
Domain Number 1 Region: 28-209
Classification Level Classification E-value
Superfamily TIMP-like 1.82e-71
Family Tissue inhibitor of metalloproteinases, TIMP 0.000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009634   Gene: ENSORLG00000007689   Transcript: ENSORLT00000009635
Sequence length 221
Comment pep:known chromosome:MEDAKA1:8:10495521:10499729:-1 gene:ENSORLG00000007689 transcript:ENSORLT00000009635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMTWMNNSCLVTLAVLLLWRVEEIAEACSCSPAHPQQAVCNSDVVIRAKLVGRQEVDAGN
DIYGNTIKRIKYDVKQIKMFKGPSHDIDAVYTAPSSSLCGVSMDTTGKKEYLITGKLETD
GTMHVTLCDFIDQWDAMTATQKKNLIQRYESSCDCKITHCTSIPCVLSSPTECLWTDWVI
EKTVKGEQAKHYACIKRNDDSCAWYRGSTPPRKEFLDIEDP
Download sequence
Identical sequences H2LU60
8090.ENSORLP00000009634 ENSORLP00000009634 ENSORLP00000009634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]