SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009696 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009696
Domain Number 1 Region: 49-498
Classification Level Classification E-value
Superfamily Sema domain 4.97e-141
Family Sema domain 0.000000119
Further Details:      
 
Domain Number 2 Region: 876-934
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.19e-16
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 822-874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 603-653
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000523
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 5 Region: 494-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000811
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 6 Region: 663-695
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 7 Region: 547-600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000798
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 8 Region: 935-979
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009696   Gene: ENSORLG00000007742   Transcript: ENSORLT00000009697
Sequence length 1103
Comment pep:known_by_projection chromosome:MEDAKA1:20:13550105:13657813:-1 gene:ENSORLG00000007742 transcript:ENSORLT00000009697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPFIQHALLLLQCMLVLHTRGAAGRRGPVLLPESPCHKKEHPAVPHSEMEPWIFRFKA
EGTVDYSQLTFDPGQNELIVGARNHLFRLNLEDLTLIQEAEWHCDEFTKGACFSRGKSEE
ECQNYIRVLLVNGNRLFTCGTNAFTPICTNRTLTNLTEIHDQISGMARCPYNPLHNSTAL
ITSSGELYAATAMDFSGRDPAIYRSLGGLPPLRTAQYNSKWLNEPNFVSSYDIANFTYFF
FRENAVEHDCGRTVFSRVGRVCKNDIGGRFLLEDTWTTFMKARMNCSRPGEIPFNYNELQ
GTFYLPELELLYGIFTTNVNSIAASAVCAFNLSAISQVFNGPFKYQENSRSAWLPYPNPN
PDFKCGTINSGTYVNLTQRNLQDAQKFLLMHDVVQPVVPVPYFMEDNVRFTHVAVDVVQG
KDMLLHIIYLATDYGTIRKVLSPLNQSTGSCLLEEIELFPPRKRQPIRSLLILHSRSELY
VGVRDQVIKIPLKRCSYHKTREACVGARDPYCGWDLLLKKCTTLEESVRMSQWEQSITKC
PVRNVTVDGGFGAWSGWSTCSHNDGGSAGSCLCRTRACDNPAPQCGGQTCFGISAEVANC
SRNGAWTPWTSWSPCSTSCGIGFQVRQRSCSNPSPRHGGRVCVGQNREERYCNEHLPCPP
HVYWSAWSAWDRCNVPCGGGIQSRRRTCENGNDCPGCGQWQRRSYGTFWSQVIRKGQLKG
SQAPKTPSKEYQSCNTLPCPDVKKTTPWTPWTPVNISDNGGHYEQRFRYTCKARIPDPSM
LEVGRQRIEMRYCSSDGSTGCSTDGFIEGEVLRLGRISGHTVNGGWSAWSSWSQCSRDCS
RGIRSRKRTCTNPEPRYGGQTCLGPAQEYQECNITPCPVDGSWSCWSSWSKCSVTCGRGH
YMRTRTCSNPPPANGGDICLGLHTEEALCNTQACPESWSRWSEWSHCDSSGAQLRVRHCD
VLFPTGNQCSGNSSETRPCSPDSNFIPEVSIARSSQEERRCGDFNLFHMIAVGLSSSILG
CLVTLLVYSYCQRYQQQSHDATVIHPISAAPLNTSITNHINKLDKYDTVEAIKAFNKNNL
ILEERNKYFNPQLTGKTYTNAYF
Download sequence
Identical sequences H2LUB9
ENSORLP00000009696 8090.ENSORLP00000009696 ENSORLP00000009696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]