SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009753 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009753
Domain Number 1 Region: 70-125
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000918
Family Variant RING domain 0.036
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000009753
Domain Number - Region: 139-222
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0275
Family ABC transporter transmembrane region 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009753   Gene: ENSORLG00000007789   Transcript: ENSORLT00000009754
Sequence length 279
Comment pep:known_by_projection chromosome:MEDAKA1:1:23390085:23405050:-1 gene:ENSORLG00000007789 transcript:ENSORLT00000009754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVQQITVVPARETATNGKSIPRSKDKNEKRTLKGKKVPGRSGSRHSNISKGSNSTAGVT
SVSRTSTTSAQDICRICHCEGDDEFPLIMPCRCTGSLSFVHQACLNQWIKSSDTRCCELC
KFDFIMETKLKPLNKWEKLHMSKSERRKIFCSVLFHLIAILCMLWSVYILVKRTTEEIKL
GKNGVLEWPFWTKLIVVAIGFTGGLIFMYIQCKVYLQLWRRLKAFNRIITVQNCPEKNLH
KSQTQCSALTNGKHETVEVPVTPAPIPTPEAQVDSDVSV
Download sequence
Identical sequences H2LUH6
ENSORLP00000009753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]