SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000009798 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000009798
Domain Number 1 Region: 832-911
Classification Level Classification E-value
Superfamily DEATH domain 1.22e-24
Family DEATH domain, DD 0.0000473
Further Details:      
 
Domain Number 2 Region: 130-221
Classification Level Classification E-value
Superfamily Immunoglobulin 3.58e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 220-271
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000523
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 4 Region: 280-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 5 Region: 23-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000463
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000009798   Gene: ENSORLG00000007815   Transcript: ENSORLT00000009799
Sequence length 920
Comment pep:known_by_projection chromosome:MEDAKA1:12:12781538:12839350:1 gene:ENSORLG00000007815 transcript:ENSORLT00000009799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDFAGLGELPETFPSDPPEPLPVFLMEPEEAYIVKNKPVNLYCKATPATQIYFKCNSEW
VHQKEHTVEERVDENSGLVVREASIEITRQQVEELFGPEDFWCQCVAWSSAGTTKSRKAH
VRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNFYIT
IDHNLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIVYVNGGWSTWTEWSVCNSRCGRG
YQKRTRSCTNPAPLNGGAICDGQGIQKLPCNPLCPGGVIVDGLWTEWSKWSTCGTECTHW
RRRDCGAPAPKNGGKDCEGTVLQSKNCTDGLCMQSSLNPKSSEAKGKNDLGNSLAPSTDD
VALYVGIVIAVIMCLVISVVVALFVYRRNHRDFSSDILDSSALNGGFQPVSIKTARKADL
LTAPPDLTSAAALYRGPVYALHDVADKIPMTNSPLLEPLPNLKIKVYNSSGLVTPQDDLG
GEFSSKLSPKLPHCLLDNSDSTMGRRTQSQTLLRTRDPSCTALGSFSSQGGQLIVPNSGV
SLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMH
HCAVCDGQQDWLIQLKSQSQQNQWEDVVVVGEENFTTPCYVQMDDEACHILTETLGTYCL
VGQSLSAATIKRLKLAIFGPVTCAAMEYHIRVYCLDDTQDALKEVLQMEKQMGGKLLDEP
KTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVWSGSQRNLHCCFTLERFSTS
TVDLTCKICVRQVEGEGQIFQLDTTLSEDSQSIDTSLLDPASNITTLVGPNAFRIPVSIR
QKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSRL
AQVLEEMGRHDSLVPAVFEH
Download sequence
Identical sequences H2LUM0
ENSORLP00000009798 ENSORLP00000009798 8090.ENSORLP00000009798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]