SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010153 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010153
Domain Number 1 Region: 152-299,340-355,458-501
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.47e-49
Family Hemopexin-like domain 0.00059
Further Details:      
 
Domain Number 2 Region: 21-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000314
Family Somatomedin B domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010153   Gene: ENSORLG00000008088   Transcript: ENSORLT00000010154
Sequence length 510
Comment pep:known_by_projection chromosome:MEDAKA1:13:16410422:16414064:-1 gene:ENSORLG00000008088 transcript:ENSORLT00000010154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLWDVLLPALLIGAFAEDAQESCLDRCENGFDSQRKCQCDSMCTYYKSCCFDFEAICGM
MTRGDTFDFAEDEDYVFESTTPAAERPSDSNHSPHQRPEATLHMTRSSRLINEKVTRSPN
TDNVAITTKAPGTNATTETSTVPSKTATTQAPDPDAEVCSGRPFDSFMQLKNGSIYAFRG
EYFFELNQRSVLPGYPKLIKDVWGISGPIDAAFTRINCQGKTYIFKGNKYWRFDNGVLDD
DYPRDISVGFDKIPDHVDAAFALPAPHHHGKEKVYFFKGDQYYMYEFLHQPSHEECAIIS
EHSPSTLFRRYTDMYYNNFERYFSELFSDLPQHHDKHHFINKDWKGLKSPVDAAMAGRIY
VTPRGLIPRRYNYQPDQQWGRQQGQQWGRQYQQNGWQWGRRRSNRSPNWGSMSERGINMG
QGFAERGMEDWDQDRRRDVYNQNNRGNYDSRDDRFFRTDMPIQNVYFFKGDKYFRVDLST
KRVDPAMPPYPRSIAKYWLGCSDTPELERK
Download sequence
Identical sequences H2LVM0
ENSORLP00000010153 8090.ENSORLP00000010153 ENSORLP00000010153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]