SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010208 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010208
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-19
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 
Domain Number 2 Region: 55-81
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000235
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010208   Gene: ENSORLG00000008131   Transcript: ENSORLT00000010209
Sequence length 175
Comment pep:known_by_projection chromosome:MEDAKA1:12:13149422:13151707:1 gene:ENSORLG00000008131 transcript:ENSORLT00000010209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYYCDYCDRSFQDNMHNRKKHLNGVQHHRAKKAWFDQFRDSAAILYDEQVKKTCRKF
LLKGFCDFGANCRFSHMSEEEQLMLKRQLEDEKQNKEDAADRMMAGRSVQEWLSKREKRK
AALSSKGDLKTKEDREEVEEDNEIPHQLLSMPDLPPSLLPPPPGGWRVFVNAEWD
Download sequence
Identical sequences H2LVS3
XP_004074829.1.28442 XP_011480115.1.28442 ENSORLP00000010208 8090.ENSORLP00000010208 ENSORLP00000010208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]