SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010374 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010374
Domain Number 1 Region: 250-362
Classification Level Classification E-value
Superfamily SH3-domain 1.41e-21
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 2 Region: 72-131
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000718
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010374   Gene: ENSORLG00000008267   Transcript: ENSORLT00000010375
Sequence length 369
Comment pep:known_by_projection chromosome:MEDAKA1:19:8583178:8591184:-1 gene:ENSORLG00000008267 transcript:ENSORLT00000010375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQRLKRSLSLKSVMRSKSVDNFFQRSNGESRPSSAFITAPPPPSPPPLSESPLGYERSP
SLSPNIQLKSQTKPLQPGKTHCFQEHVFRKPTSCQRCKHMIQGNSKQGLRCKACKLAAHL
WCSSELSQQACNGKAGAFKRNFSSPLLSIDPLGVVREAPAAQEADHVIVDPVYEALRYGT
SLAQMSRSSFGSVSESPCHETERLQEKLENQPIAEEEQIPGSDLFVLTPPESEKADSEDR
VSLKTPKRVPVHSLHTYVALYKFLPQEKNDLELQPGDRVQVTDDSNEDWWKGKSGHKVGF
FPANFVQRVRPGERVYKVTTAFHGNRDKGQMTVKEAQICVGKNEEIDGFLRLSSGKKRGL
VPVNYMIEI
Download sequence
Identical sequences H2LW87
8090.ENSORLP00000010374 ENSORLP00000010374 ENSORLP00000010374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]