SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010383 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010383
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-55
Family DBL homology domain (DH-domain) 0.0000224
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-33
Family Pleckstrin-homology domain (PH domain) 0.00095
Further Details:      
 
Domain Number 3 Region: 384-493
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-25
Family DEP domain 0.0048
Further Details:      
 
Domain Number 4 Region: 680-746
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000657
Family PDZ domain 0.017
Further Details:      
 
Domain Number 5 Region: 584-678
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000276
Family PDZ domain 0.016
Further Details:      
 
Domain Number 6 Region: 478-527
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000109
Family DEP domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010383   Gene: ENSORLG00000008271   Transcript: ENSORLT00000010384
Sequence length 1596
Comment pep:known_by_projection chromosome:MEDAKA1:20:15040110:15136488:-1 gene:ENSORLG00000008271 transcript:ENSORLT00000010384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESRNEHRAESGKDLEKQLRLRVCVLNELLKTERDYVGTLEFLSVFLHRLNQYAATKM
DKNITEETVKVLFSNIEEVLAVHKSFLSMVEELLQPDPHAHHEIGRCFLHFRSRFQVYGE
YCGNHEKAQRLLLELNKIRSVRTCLLNCMLLGGRKNTDVPLEGYLVAPIQRICKYPLLLK
ELLKRTHRKHNDYTQVQESLQMMKAVCSSINEAKRQMEKLEILEELQSHIEGWEGSNITD
TCTEMLKQGVLLKISAGNIQERIFFLFDKLLVYCKRKNRRLKNSKATSEGPRYLFRGRIN
TEVMEVENVDDGTADYHSSGNIVNNGWKIHNTAKNKWFVCMANTPEEKQEWLEAIMQERE
RRKSLRLGMEQDTWVMVSEKGEKLYHLMTKGNLIKDRKRKLTTFPKCFLGSLQSELVPWL
MEIGETANPEEGVHLGQALLENGIIHHVTDKHQFKPEPVLYRFRYDDGTFHPRSDMYDVI
SKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQPDANLDEENNTSGSFN
SCGLGCKHHKMAEQSTYKETPYLTLIMSKEETSFEKLSSKTLKHDLKIVENVITKSLLIR
PSDGGYGFTLEERNRVPIIKFVEKGSPAEMAGLEVGKKLFAINGDLVFLRSFSEVEVILR
QCFTNKGPIRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQ
CIIKVNGINVSKESHASVIAHVTACRKYRRPSQQDTIKWVYNTSESAQEDNQKTNQKPTT
EENGDGFECKVEEVMDKFNTIAIIDGKKDHVSLTVDNVHLEYGVVYEYDSTAGIKCHVLE
KMVEPKGFFSLTAKILDMFARNDDLLVQMCGKLSSSCEVIPEELQKRFSSMYTERVEHIN
RRIANYRKFSRVLKNRAWPTFKQAKAKVSPLHSSDFCPTNCHINVMEVSYPKTTTSLGSA
FGVQLENRKNSLEKGGCSRAEQRKLSPTVNVQHAITTMAAPSGHSLGRTEGHGLRFLLRE
DDLLMLDAYQKLLYKLTAVFKDLETHGGHIHDLISSTTHPPAPEVRTLESYISAESEGEK
CERNGKKVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYLHSDE
MDSGDEVPSSVWLSHEKQKKLHSFLEHLFSQVDTITSTLRGPVVARAFEQTKCFTPGRGF
QEFQQEMEPKVNCTKKLRLHVKQDPWNLPSSVQALTQTISKYVEEVKTRLLLVLLQYTES
HKQIQQPKKKIFCEFSAKLFCDLINMSKNIKHNLTNVFFSSVVDFNFASILFLLQTDEQA
MLEDTQVALMDLEKVTFYFQQFEGEPLVANTPISYQVEGTRQALKVCFYLESFHFAQLPY
RLKSRGGVKIYPVLFTQGKVGLXGYYYRDSISVEEYQARINAASLDKVKQYHKRLRAFFL
DQSNMTPSTSPKAALIDKFMRPFNALEDLYRLMESFISCRRTAACQYTACGASGVGLLTV
ASELCSRLGATHVVMCNSGVHRINSCTLSVTLEQATLLARNHGLPPRCIMQTTDVMRKQG
ARVQNSAKNLGVRDRTPTSVPRLYKLCQPPPPDGDP
Download sequence
Identical sequences H2LW96
8090.ENSORLP00000010383 ENSORLP00000010383 ENSORLP00000010383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]