SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010450 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010450
Domain Number 1 Region: 102-316
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-59
Family DBL homology domain (DH-domain) 0.00000000414
Further Details:      
 
Domain Number 2 Region: 301-455
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-47
Family Pleckstrin-homology domain (PH domain) 0.000000131
Further Details:      
 
Domain Number 3 Region: 15-118
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-20
Family SH3-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010450   Gene: ENSORLG00000008324   Transcript: ENSORLT00000010451
Sequence length 522
Comment pep:known_by_projection chromosome:MEDAKA1:10:18428295:18446419:-1 gene:ENSORLG00000008324 transcript:ENSORLT00000010451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVIVFVLLISGGSVVNAEAVWDHVTMADRELAFKAGDVIKVLDASNKDWWWGQIDEEEG
WFPASFVRLWVNQEDGGVEPAEGTSEVQNGHLDPTNDCLCLGSPLQNRDQMRANVINEIM
STERHYIKHLKDICEGYLRQCRKRVDMFNDDQLKVIFGNIEDIYRFQMGFVRDLEKQYNT
EEPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMRDGRYQHFFEACRLLQQMID
IAIDGFLLTPVQKICKYPLQLAELLKYTAQEHSDYRYVAAALAVMRNVTQQINERKRRLE
NIDKIAQWQASVLDWEGDDILDRSSELIYTGELSWIYQPYGRSQQRVFFLFDHQLVLCKK
DLIRRDILYYKGRIDMDRYEVRDAIDGRDDDFNVSVKNAFKLYNKDSEEIHIFLAKKPEE
KIRWLRAFHEERKMVQEDEKIGFEISEYQKRQAAMTVRKVTKQKGVNRCTPPSYPPPQDP
LSAGQYEVMEDMAQGEVFEFSQSKRGQAPFWQNFSRLAPFKK
Download sequence
Identical sequences H2LWG2
ENSORLP00000010450 ENSORLP00000010450 8090.ENSORLP00000010450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]