SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010451 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010451
Domain Number 1 Region: 35-249
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-59
Family DBL homology domain (DH-domain) 0.00000000414
Further Details:      
 
Domain Number 2 Region: 234-388
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-47
Family Pleckstrin-homology domain (PH domain) 0.000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010451   Gene: ENSORLG00000008324   Transcript: ENSORLT00000010452
Sequence length 407
Comment pep:known_by_projection chromosome:MEDAKA1:10:18431855:18441065:-1 gene:ENSORLG00000008324 transcript:ENSORLT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLWVNQEDGGVEPAEGTSEVQNGHLDPTNDCLCLGSPLQNRDQMRANVINEIMSTERHYI
KHLKDICEGYLRQCRKRVDMFNDDQLKVIFGNIEDIYRFQMGFVRDLEKQYNTEEPHLSE
IGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMRDGRYQHFFEACRLLQQMIDIAIDGFL
LTPVQKICKYPLQLAELLKYTAQEHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQ
WQASVLDWEGDDILDRSSELIYTGELSWIYQPYGRSQQRVFFLFDHQLVLCKKDLIRRDI
LYYKGRIDMDRYEVRDAIDGRDDDFNVSVKNAFKLYNKDSEEIHIFLAKKPEEKIRWLRA
FHEERKMVQEDEKIGFEISEYQKRQAAMTVRKVTKQKVFMKMESWFY
Download sequence
Identical sequences H2LWG3
ENSORLP00000010451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]