SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000010893 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000010893
Domain Number 1 Region: 1261-1445
Classification Level Classification E-value
Superfamily vWA-like 1.59e-31
Family Integrin A (or I) domain 0.0000576
Further Details:      
 
Domain Number 2 Region: 1685-1867
Classification Level Classification E-value
Superfamily vWA-like 3.52e-31
Family Integrin A (or I) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 1485-1656
Classification Level Classification E-value
Superfamily vWA-like 2.74e-22
Family Integrin A (or I) domain 0.0047
Further Details:      
 
Domain Number 4 Region: 288-342
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000327
Family BSTI 0.023
Further Details:      
 
Domain Number 5 Region: 641-705
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000768
Family BSTI 0.071
Further Details:      
 
Domain Number 6 Region: 2200-2257
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000409
Family BSTI 0.032
Further Details:      
 
Domain Number 7 Region: 762-822
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000311
Family ATI-like 0.035
Further Details:      
 
Domain Number 8 Region: 1137-1189
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000458
Family BSTI 0.076
Further Details:      
 
Domain Number 9 Region: 2570-2650
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000774
Family VWC domain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000010893
Domain Number - Region: 820-860
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family VWC domain 0.067
Further Details:      
 
Domain Number - Region: 352-379
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00106
Family PMP inhibitors 0.0013
Further Details:      
 
Domain Number - Region: 683-736
Classification Level Classification E-value
Superfamily FnI-like domain 0.023
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000010893   Gene: ENSORLG00000008677   Transcript: ENSORLT00000010894
Sequence length 2813
Comment pep:known_by_projection chromosome:MEDAKA1:6:14029066:14048412:-1 gene:ENSORLG00000008677 transcript:ENSORLT00000010894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQSNGLRDILLIFMPLLIPACVAGVTGRCSLFGRYHVHTFDGVLYEFPGDCSYLLAGDCS
HRSFTLLGDFHNGKRTGVTLFLGDAFELHLSVDGFLSQREKRLTLPYASHAVFAGSELGF
YKLWSEEFGFTVTIDNAANIALTLSKHHANRTCGLCGNFNAVTADEYTAQEGLLTEDSYD
FANSWAVKGADQSCRRVSNPSKSCNSTKGTEAILSSCSVLKTSGVFLHCAHLVPPEAFLL
LCQAEACHCNQRDVEDCYCPILLEYARTCHAHGILLHGWLEESKCYPKCPIGMQYSECTK
SCSTTCHSLNIQEVCKDECMDGCTCPAGKVLDGNRCVEVSECSCTHMGRHFPPGSTVSQD
CNTCVCRHGSWECTNEGCPGECLVVGQSHFKSFDNKFFTFTGDCQYLLAKDCVNNEFSVI
IENVQCADNQDAVCTRSVTLSLPSLENMTVKLKHGGVVSVNNMDIQTPMHYGHLHIQRAV
QSSVRLVFSDDLRLDWDGQGRVLLKLTARWTGQTCGLCGNYNGNQGDDFMSDSGLVETKP
QAFGQAWKINGDCESTHKYDPDPCAINPKRVRFAEEACAVIMSDVFSPCHILVNPSPFQR
FCRYDVCACGDGEKCLCSALAAYAASCSAKGVLVNWRSALLCELECSGGQVYEACGTVCD
RTCLSLSGAEAGCEGEKVCEEGCFCPVGKYLSPSGQCVTADLCPCLHDGQLYQPNDVYAD
HTSICYCENGSMRCSSSEDILSELNNKIFDNVPVCAERRSAHCPPPLVRTECGSGKKGLE
CARTCQNLDLPCVSLSCIPGCLCPPDTVRHRRDCIAPEQCPCYHNNRPYAAGQTITTDCN
TCVCENRKWRCTQKLCDGVCRSVGEGHYITFDGLKFSFPGLCQYVLVQDMCLGEEGSFRV
LVENEACGIVGRRCAKAVTVFYQGGLIVMQHGEVTMKKPVPQSSQVEIIRSGQFYTLLLG
KHISLSWDRGTRLLVHISAAYRGRVCGLCGNFDGNVNNDFMSSNNQLEVDSSHFGNSWKV
IPSCADVTQVQIPLPCSDNIMKLVTVEQSCRLMSGPLFKECNTQVDAEPYVEMCVEAACS
CPSVGDCACFCDVVAAYAQACSERGISISWRSNDLCPMSCEELNPKISGVGEELCQWRYN
TCGPACPITCQHPEPLQCSFTCVEACHAYCPPGQLLDEVAMRCVNPSQCQMCVHNGQRIS
HGNKVILNHDNPALCKICHCENNSLSCEDCTSLSMLSTPTPTPSWGTDTTLAFTTLMPED
TCDRAMDLAFLLDGSEVLNEDEFQATKEFILGVVERFRMGSAHTRATVLLYHSGVKTYDL
QNQVQKWLFKKTVRELRYTGGDAAFLDEAVKYLAVNIYDKNKREHAGRVAIILTASTNPR
PIRSIVKMLRKKAITTLTVALGPGVNMAQVNDITNANPDNRAYVLSSTAELPDHLLELTD
YLCTLGMEPEVPKPIKYVPNAVSTTPSVLSPATTLPSPYIPAPHVTFILEGSDGVGEVNF
NKSLFFLEEVISQLTEEEELIRITVIQYSVTVTVEIRQWEIRKQRHQLVQRLRQIRWRGG
NKTNTGTAVSKTLQELQTNQPSPGSTPPQLVFLVTENPPTDTVTRPQSIGTQTHVYPIGV
GPKIREIDLFPFSSPQRPLMVDDYNHLSTLVHRVVNITHTTVRPRSPTLPPLVLPTHASL
PPTVPCQKPVDVLFLLKAGVNFEDMKMFVKAFIMGADIGLNGTQVSVIQYGDTNTVELWW
RDHQSKTKLQEILEKAPSRTTAAPARSALRFAVQTSIAPVSGGRIGVAKVIVMLVTAKSS
DEVKEAANEALAAGVSVFPIGIGQGYDMNELTVLGRHGNQDNILQLSNMDQLSMLLTLDN
TYRERICRAGPPGVCVDDNGNERKPGESWLLDDGCHSLLCHPSGAVTVQSHKVSCDKLEP
PACRNNMAPVKVQDTCSCHWECPCMCMGSSTNHVVRFDSLALRLDGEGLCSYTLLTVNSD
SGEGSEVKLHTGPCQETTSYNQICMKAMEVTHGPHKLILRDDMRAMIDREELALPWRFYG
MELMRYGGVMLQLKSNQGYMLTFTPQSNEFTITFQGSTNSAQTAGLCGACGEEKVNILSL
RNGSSTTNQPAFISDWTAAGEDGVCLPKRQSVCLSGAAMGCQALHSEVFLPCHAFIPVQI
FLTKCEEQACEESDACEVISAYARLCRQRGVCVDWRSPHLCPLKCPSSMEYDACRTGCVE
DCDRSNESCMDTPTEGCFCAGGTVLHHGRCVSPEACGQCVDQHGHTYTHMQSWVPDENPC
LICMCLDQQRINCTARPCNDVKAPECGACEILRERKGSMCCPEYECVCDLVNCALPEVPQ
CVDGQTLLLKNPGDCQPIHECVCKKEECALQTPPDCPAHRQLSVKKTTCCDVFECLCNCQ
NSTRTCPTGFITSSLINNCGCTETNCLPDKVCVVDGMVHPVGSEWEEGCKKCSCTELQDK
DTLLHVAQCKPLMCDLNCPLGSTYTPVRGVCCGRCTPTSCIESAGDMRGDTLVGGKEVGE
VWHPPHDRCTIHQCVKVKDAVFISTTNVSCAIMDAPACPLGTELHCETVDCCPRCYCAPV
QGCILNHTVIATGDQVMLDVCTHCKCTVENGPVTKYKLSCRKTSCPTCPTGYTLQKEEGS
CCGRCIATACVTQKPDGNLISIQVNSTREDGCNLYTCGVNKRGDLVLETKMTTCPPFNQK
NCLDEGGKISKIGKTCCEMCSQPECRRTVGTLNYIKVDDCQSEKQIELRYCEGKCRSKST
YSLQRAAVEQECVCCTAVETEPLSVPVLCTNGTRSHHTVLSVTKCDCLSKRCT
Download sequence
Identical sequences H2LXN2
ENSORLP00000010893 8090.ENSORLP00000010893 ENSORLP00000010893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]