SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011080 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011080
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily SH2 domain 1.66e-28
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 204-258
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000788
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily SH3-domain 0.000000182
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011080   Gene: ENSORLG00000008827   Transcript: ENSORLT00000011081
Sequence length 259
Comment pep:known_by_projection chromosome:MEDAKA1:1:25283195:25288215:-1 gene:ENSORLG00000008827 transcript:ENSORLT00000011081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVALFSFSASEADELSFQKGDIVKVTEMEEDSYWVIAEIQGRRGFVPVNYISLLPHPW
FAGAVSRLEAEQHLRWQVTGVFLVRQSESAPGEFSFSVSYGDRVEHFRVLEGGGQYCIWD
KAFCSLNRLVDFYRTHSIAVEKVVCLRDAPSSPRVQSHPARNPYPSPHRHSSQESISSAH
LHSRPCYPERDSSLNLQKPFLEMPRLANALCDYTPDQTTHLHFLRGDVIELLDCSSSLGW
RGRCRGRVGIFPPKFVHPL
Download sequence
Identical sequences H2LY66
ENSORLP00000011080 8090.ENSORLP00000011080 ENSORLP00000011080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]