SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011213 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011213
Domain Number 1 Region: 7-216
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-54
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 200-340
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-27
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 3 Region: 356-423
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 379-538
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000056
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011213   Gene: ENSORLG00000008939   Transcript: ENSORLT00000011214
Sequence length 557
Comment pep:known_by_projection chromosome:MEDAKA1:23:946251:957602:-1 gene:ENSORLG00000008939 transcript:ENSORLT00000011214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGEPKGEEAESRLYHIANELLQTERAYVARLHLLDRVFCLQLTEEAERGSFPPEVVRMIF
SNISSIYSFHSQFLLPDLESCICHWREGPGLGKALLQHAPFLRMYADYVRNFDAAMELLK
TWTERSSAFRSVISDVQSRDVCGNLTLQHHMLEPVQRVPRYEMLLKDYLRNLPEDHPDLH
FSQKSLLAISMAAIHSNSAIQKAESLKRQLEIYEMVGEEEVVNPTNEFLKEGRLLKLAAR
NTLAMERHLFMFNNFLLCCYPRFSLVGQRFTVRCRIGVDGMRVHQTSNEDHPHTFQVSGK
ERTLELQASSEQDRDEWIKVIQDAIAEFQQKHETFRLASKDLCVEKPKKELGKCAPRWIR
DNEVSHCMTCQEPFNALTRRRHHCRACGYVVCWRCSENKVALEYDGNKLNKVCKACFPIL
TRPRGGEEEDRLLPESQFGERSGETVLSGFLQYEDASMVLQQAWCVLTRSLPPCLQVFAA
PQDTTPLLAVPLLDAVITSSSPELSSRHLFCVKRFKTLHTFSCDSLEVKQSWTTLLKTTA
MGWAQTPTASSRSTTAP
Download sequence
Identical sequences H2LYJ5
8090.ENSORLP00000011213 ENSORLP00000011213 ENSORLP00000011213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]