SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011263 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011263
Domain Number 1 Region: 79-283
Classification Level Classification E-value
Superfamily Bet v1-like 9.95e-39
Family STAR domain 0.0000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011263   Gene: ENSORLG00000008980   Transcript: ENSORLT00000011264
Sequence length 294
Comment pep:novel chromosome:MEDAKA1:19:9822604:9825002:1 gene:ENSORLG00000008980 transcript:ENSORLT00000011264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAVVKLCCGISYPHMRSMAATAGLQRRAVAVIGQEITQLQQWGQIQQHLRTHVALNYN
EVEQEDVQPAAKSGNQLYYEQHGREAMRKALSMLEDKDGWKVEMTESNGDVIYSKVIPGA
GKVFRMEAVLEATVDELYDILYARVQEMPQWNPSIQHIEVLKHVGPETIVTHEVSAGSAG
NLIGQRDFVSVRHSCKQKSRVYLGGAAIQLESFPPQAGFVRKQFTGILXXXXIVLQAFDE
DKTKSRFTWVFNMDVKGWLPKSIVNQALPRAQLDFTRHLRRRLGGRCMSLHDSL
Download sequence
Identical sequences H2LYP4
ENSORLP00000011263 8090.ENSORLP00000011263 ENSORLP00000011263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]