SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011290 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011290
Domain Number 1 Region: 256-458
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.52e-49
Family Reprolysin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 552-603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 969-1019
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 899-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 5 Region: 846-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000017
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011290   Gene: ENSORLG00000009003   Transcript: ENSORLT00000011291
Sequence length 1095
Comment pep:known_by_projection chromosome:MEDAKA1:19:9828003:9877461:-1 gene:ENSORLG00000009003 transcript:ENSORLT00000011291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPLWIKFSALKPSLTWACECFSHFVPSEKVSGKLREYGLIVPFSTDSHGRYISHVVSAG
SGSKSSDAASSLGSISSSSRRRRRVARGAPEMPSATSPAAQHLFFNVTVFGKELHLRLKA
NRRLVAPGAFVEWQEDFKEKSKEHISGDCVFTGDVTDMPEASVAISNCDGLAGLIRTDKG
EFFIEPLEKGQQDVESKGRVHVVYRRSAIKAGQQKSDFHNEVADVGIADLPAALDLVEHK
LSESERKRRHAKKDDYNIEVLLAVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGTN
INIVLVRMIMVGYRQSISLIERGNPSRSLEQVCRWANTQQRHNPDHAEYHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPLRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCADETS
MGSIMAPLVQAAFHRYHWSRCSKQELNRYIHSYDCLLDDPFEHKWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTYDPCKQLWCSHPDNQYFCKTKKGPPVDGTDCAPGKWCFKGHC
IWRSSQEPQGHDGSWSSWSKFGSCSRTCGGGIRSRSRQCNNPPPAYGGRDCPGSAFDYQM
CNTEECAGAYEDFRAQQCIQRSNKYHKNMKHTWLPYEDPDDSRKCELSCISKETEEIVFM
NQVVHDGTRCSYSDPYSVCARGECLHVGCDKEVGSYKEEDKCGVCEGDNSHCRTVKLTLT
KTPKKNGMLKMFDIPIGARHIVIEENETSSHIIAVKNQVSGNFILNEKSEDAKLKTFIKN
GLQWEYSSDGDRETLKTSGPLHDGIVVLVIPMEEEVKISLTYKYIIHEDLLPLITNNNVL
LSELDTYEWALKSWSQCSKPCGGGIQYTKYGCRRKSDGRLVHRNFCESSKKPKPIRKRCN
MLECSQPKWVMEDWSPCSKSCGKLGYQTRVVQCMQALHNGTSRPIHSKHCPTNRPETRRV
CNHTACPAQWRTGAWSQCSVSCGEGIQQRQVVCKTSDNTVGECEGEKPETVLICKLSPCP
GSGRLPLSSPSSQMTENATMNGEAVYQMVPKNPVDKMSNEPCLGDKSIFCQMEVLARYCS
IPGYYKLCCESCSRK
Download sequence
Identical sequences H2LYS0
8090.ENSORLP00000011290 ENSORLP00000011290 ENSORLP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]