SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011301 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000011301
Domain Number - Region: 167-220
Classification Level Classification E-value
Superfamily TIMP-like 0.000746
Family Tissue inhibitor of metalloproteinases, TIMP 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011301   Gene: ENSORLG00000009015   Transcript: ENSORLT00000011302
Sequence length 296
Comment pep:novel chromosome:MEDAKA1:8:12484127:12487813:1 gene:ENSORLG00000009015 transcript:ENSORLT00000011302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSSLLCSLTSGAFTFSFLALHGAADLCNWTGSGFASADSRVVFQVRLSCAEGSVKWLY
PVQALRVVLDPKVSSARRNRICIKPFASSGGVSMFVERAGKLQLMQEQRARARRQVICFS
ADGAERPAIYLQASPRSNELWGRHVIGFRYELMGNRSTAPLGGMQASCRPCSDAELLMAI
CNSDFVIRAHIKNVSHDRQSQTSSVEVSASRVYWQRSGVFEQQLDPSASLPSLSWHGHIH
TLLDCHVKPGDGEFLFTGSEHFGEAWLGCAPRYKTFLSVYEKARQERRNSCDFPLG
Download sequence
Identical sequences H2LYT1
8090.ENSORLP00000011301 ENSORLP00000011301 ENSORLP00000011301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]