SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011481 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011481
Domain Number 1 Region: 240-459
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.05e-56
Family Reprolysin-like 0.00035
Further Details:      
 
Domain Number 2 Region: 550-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000353
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 827-888
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 891-948
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000615
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 5 Region: 1006-1058
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 953-1006
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011481   Gene: ENSORLG00000009150   Transcript: ENSORLT00000011482
Sequence length 1109
Comment pep:known_by_projection chromosome:MEDAKA1:4:15729630:15774755:1 gene:ENSORLG00000009150 transcript:ENSORLT00000011482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLWRTGLACTVIIIMVASEVAEGRRDDFAQSQAAFLSNLGQYEIATPVRVGPNGEKFD
GDNSHHQRRRRSPEDRLHDTLFYQLSMSQNNFLLNLTLQGGLLSHQFRVEYWKRGQLAWS
HPYSPHCHYTGHLQDQPHSSKVALSNCNGLQGVIVTGGEEYLIEPLVSPDNQTKTEGSER
TEERPHVVYKRSSLRHQYKGRSCGVIDEKPLKSLSWWQRTLKTPPHLVGRGQLPLKRSVS
QERYVETLVVADKMMVGYHGRRDIEQYILAVMNIVAKLFQDSSLGNAVNIVVTRLILLME
DQPTLEINHHAGKSLDSFCKWQKSIQHRNSYGNAIPDNGIAHHDTAVLITRYDICIQKNK
PCETLGLAPVGGMCEPERSCSINEDIGLGTAFTIAHEIGHTFGMNHDGMGNTCGPRSQET
AKLMADHITMKTNPFIWSACSRDYITSFLDSGMGSCLNNVPLKQEFVYPTTAPGQAYDAD
EQCRFQYGIRSRQCKYSEVCSELWCMSKSNRCITSSIPAAEGTICQTNTIEKGWCYKRMC
VAYGTRPEGVDGGWSLWSPWGECSRTCGGGVSSSVRHCDSPRPTIGGKYCLGERKRFRSC
NIDECPAGSRDFREIQCSDFDNIPFRGKFYTWKPYRGGGVKPCSLNCLAEGYNFYTERAP
AVVDGTPCRDESLDMCVSGECKHVGCDRVLGSDVREDRCRICGGDGSSCVSVEGVFNDSL
PEGGYEEVVRIPKGSVFIHIQELNMSLNYLVLKSKSDQYFINGKLTIDTPRRFNVAGTTF
HYRRPTDGPETLEALGPTNITLIVMVLVREENPGIHYRFNPPLNRDPLNGFSWFYTSWSR
CSVLCAGGVQIQQVVCKRLLDHTVVYNHFCDKKSKPKEKRRSCNTEPCSPTWWTGGWSEC
SRSCNGGLRTREVLCKRRISVTEEKILDDSACSSHRPSLTEPCNNHSCPPEWLALDWSEC
TPSCGPGYRHRVVLCKSGESGDILSESRCPKHGRPTSRVRCNLKRCPPPQWIVGPWGECS
AKCGLGQEMRLVQCLTHTGQPSNECLDHQRPAAMQQCRSKCDLNLPISTENTEECKDVNT
VAYCPLVLRFKFCSRPYFRQMCCKTCQGH
Download sequence
Identical sequences H2LZA9
ENSORLP00000011481 XP_020558087.1.28442 ENSORLP00000011481 8090.ENSORLP00000011481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]