SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011688 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011688
Domain Number 1 Region: 242-371,407-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.83e-37
Family Hemopexin-like domain 0.00095
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000536
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000484
Family Somatomedin B domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011688   Gene: ENSORLG00000009323   Transcript: ENSORLT00000011689
Sequence length 473
Comment pep:known_by_projection chromosome:MEDAKA1:4:15932415:15939978:1 gene:ENSORLG00000009323 transcript:ENSORLT00000011689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALKLPCAVMLLVCALKFSATQTSCKGRCGAEYYRGYMCQCDYGCLLYEECCTDYESQC
TTQNSCKGRCGETFKRGRLCTCDSDCIKFKQCCPDYKTQCESEVFFSEGSSTPVTDPLQW
DLLGLALCLVQSQNSTFHHFGDSINALSWYTESVKPFEFADIEAEVPVATTVPDSTSGDG
SSPSDLLDQVPTDPTVDGDVSLTQMTVSVSGDPLTSSQAPGDQEQELDQKRTFSTDDSND
KNLCSGRPISGVTTLRNGTIAVFRGHYFWFLDRNRVPSPPQSITQVWGVPSPIDTVFTRC
NCEGKTYIFKGSRYWRYDNDVLEPGYPKVIKTGFDGLRGHITAALSVPQYRSRREAVFFF
KRGGFVQKYSYQAGTSRTCGRKVGNPIVTVRYRSARQAATILEPAINIRKSWKGFPFQIT
AAVSVPSTQEQEGYKYFVFSRSSTYNVRISGERPTIAAKENATPQSNSFFTCP
Download sequence
Identical sequences H2LZW5
ENSORLP00000011688 8090.ENSORLP00000011688 ENSORLP00000011688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]