SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011703 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011703
Domain Number 1 Region: 392-611
Classification Level Classification E-value
Superfamily Bet v1-like 1.1e-39
Family STAR domain 0.0064
Further Details:      
 
Domain Number 2 Region: 5-112
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-24
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011703   Gene: ENSORLG00000009331   Transcript: ENSORLT00000011704
Sequence length 620
Comment pep:known_by_projection chromosome:MEDAKA1:9:13638669:13656840:-1 gene:ENSORLG00000009331 transcript:ENSORLT00000011704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKSSSSGSDEDIDPESAQPVEFGGVLSKWTNYIHGWQDRWVVLKNNTLSYYKSEDERE
YGCRGSLCLSKAVITPHEFDECRFDISVNDSVWYLRAEDPEHRQRWIESIEVHRAESGYG
SESSLRRHGSMLSLTSAASALSSTSTSSFKKGYRLREKLAEMETFRDILCRQVDTLQKYF
DSCADVVSKDEFQRDGVTEEDEDEFLTAARPDGENNNGSKEKLFSSANPKGTNGIDFKGE
AITFKATTAGILSTLSHCIELMVKREDSWQKRLDRELEKRRRVEDAYKSALNELKKKSHY
GGPDYEEGPNSLINEDEFYDAVEAELDRQDKIEEQCHSEKIRKPYLSPVPPGDVFSVIGT
HRFANKPHSYCSSLSSVELVSASDEIHRFSAQVEEMVQNHMTYSLQDVGGDANWQLVIEE
GDMKVYRREVEENGIVLDPLKATHNVKGVTGHEVCHYFWDTNFRMDWESTIENFNVVETL
SDNAIIVYQTHKRVWPASQRDVLYLSAIRKVHATNENDPDTWLVCNFSVEHDKALPTNRC
VRAKINVAMICQTLVSPPEGDREISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPK
FLKRFTTYVQEKTTGKPILF
Download sequence
Identical sequences H2LZY0
8090.ENSORLP00000011703 ENSORLP00000011703 ENSORLP00000011703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]