SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011850 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011850
Domain Number 1 Region: 158-379,423-473
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-51
Family LacY-like proton/sugar symporter 0.045
Further Details:      
 
Domain Number 2 Region: 589-730
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.12e-18
Family Glycerol-3-phosphate transporter 0.027
Further Details:      
 
Domain Number 3 Region: 496-566
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000111
Family Pentapeptide repeats 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011850   Gene: ENSORLG00000009453   Transcript: ENSORLT00000011851
Sequence length 740
Comment pep:known_by_projection chromosome:MEDAKA1:9:13714125:13733905:1 gene:ENSORLG00000009453 transcript:ENSORLT00000011851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PALRTRMEDTYNHRTSLVKGAKGVVKEAKRHAQKKVGKVVDRATDEYSSHQNYKRFQDDE
DDDEDIYRSSQAQDGQSYNENEGGSSDATEGHDDEDEIYEGEYQGIPSAGDTKQKKSQVA
LGQPVSDATRDRSDLEQERQADEEELAQQYELIIQECGHGRFQWQLFLVLGLALMSDGVE
VFVVGFVLPSAETDMCVPNSSSGWLGSIVYLGMMIGAFFWGGMSDKLGRRQCLLVCMSTN
GFFAFLSSFVQGYGLFLFCRLIAGFGIGGAVPIVFSFFAEVLSREKRGEHLSWLCMFWMI
GEIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVGAVVALTFMPESPRFYL
EVGKHDEAWMILKQIHDTNMRARGQPEKVFSVNRIKTPRQLDELVEMNSESGNPVSKLCF
RLKTEIQGIYLNLKKCFNYPMQENMMRLAVVWFTLSFGYYGLSVWFPDVIKHLQADEYAS
KVMIHNNERIESFTFNFTLENQIHKNSLFINDQFINMKLKSVTFVDSTFRNCYFDDVTSV
GSYFRNCTFIDAYFYNTDIDDSKLIDGTEVINSTFTHNKIGCQMTFDDDYSAYWVYFINF
LGTLAVLPGNIVSALLMDKIGRLSMLGGSMILSGISCFFLWFGTSESMMIFMLCLYNGLS
ISAWNSLDVVTTESFPTVRRGTGFGFCNALCKLAAVLGNLIFGSLVGITKAIPILMASSV
LVGGGLVALRLPDTRANVLM
Download sequence
Identical sequences H2M0C6
ENSORLP00000011850 ENSORLP00000011850 8090.ENSORLP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]