SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011912 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011912
Domain Number 1 Region: 692-752
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000241
Family VWC domain 0.0046
Further Details:      
 
Domain Number 2 Region: 860-925
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000167
Family VWC domain 0.033
Further Details:      
 
Domain Number 3 Region: 770-840
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000262
Family VWC domain 0.03
Further Details:      
 
Domain Number 4 Region: 43-120
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000105
Family VWC domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011912   Gene: ENSORLG00000009503   Transcript: ENSORLT00000011913
Sequence length 945
Comment pep:known_by_projection chromosome:MEDAKA1:13:18491425:18507807:-1 gene:ENSORLG00000009503 transcript:ENSORLT00000011913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRSLLCVLSCAWWLHAGQASRLKSPTLPIQSEREPLASKELEECSFGGRSYSLEDTWHP
DLGEPFGVMHCIQCYCEPQKHRRGKKSGKVNCKNIKQDCPDLDCDDPVLLPGNCCKSCPK
DLDTKKQSDPLLDGFEFLNEKSKDDDLHKSYNDRSYQSSEDTNPGESRTADFVALLTGVT
NSWLPSSSGVARVRLTLTRTSLTFSITYERMSRPTKVVFMDSDGTTAFEYKIPKEPSDMI
CGVWKNVAKPLLRQLQSEQMRISMATSGSRGGELEGKVIKHRALFAETVSSILTSEKENS
GMGGIAMLTLSDSENNLHFILIMQGLIKHKEPVMVPIRVQLVHRQRVLREIRANITSHDP
DFAEVLTNLTSRELLLLYRGQLEITIETQGQDPRRISGFITSRKSCDNFFPFVLPTDGIS
LFLCVANKIGSCSFTQDQRGNSSEVQVAGLSSEVLGLTIELKPRRRNKRSILYDLTPEYS
KSSGQAEGSWSPMEARYIHMLLQNELFINVATAHYQEGELRGQIKALPYSGLDVPRYELP
TPLAGYFVSPPVRTGASGHAWVSVDKQCHLHYEIIVAGLSKTDDSTVNAHLHGLAEIRDL
EDSGSSHKRLLTGFFGSQAQGVLKDISAELLQHLDQGTAFIQVITKMNPQGEIRGRVHVP
NSCKFGVGGDGEEAEFGDFFVKDPEEIKKDPHTCFFENQYHAHGSNWTPNYDPCFSCSCQ
KRTVICDPVICPVQTCSRTIQPEDKCCPVCDDRKEPKDMKALKKVEEHPEGCYFEGDQTM
HAPGTTWHPFVPPFGYIKCAVCTCKGSTGEVHCEKLTCPVLTCSHPVRRSPSDCCKECPE
EERTPAGLQHGDMMQGDGPRKCKFGKNYYQNSDSWHPWVPLVGEIRCINCWCDHGVPKCQ
RKQCPILSCSNITRTDGSCCPKCADDKEAGLITKKAPEKGRNRRH
Download sequence
Identical sequences H2M0I8
ENSORLP00000011912 ENSORLP00000011912 8090.ENSORLP00000011912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]