SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000011979 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000011979
Domain Number 1 Region: 46-231
Classification Level Classification E-value
Superfamily Bet v1-like 7.69e-45
Family STAR domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000011979   Gene: ENSORLG00000009554   Transcript: ENSORLT00000011980
Sequence length 245
Comment pep:known_by_projection chromosome:MEDAKA1:12:14114242:14116451:1 gene:ENSORLG00000009554 transcript:ENSORLT00000011980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAALAGIFMWESEKIQDEEMRRCGLELEALEDVKRMYTSSATVSGQPDASWEAVMEKKDF
RVWKRPIPNSHLYEYRVLGSYNDVTPRQFFNVQLDTEYRKKWDSLVIKLEVIDRDSMTGS
EVVHWATHFPYPLYSRDYVYVRRYEVDINHNLMILVSRAVQHPKVPETQEFVRVHSYQSK
MVIRPHKSFDENGFDYLLTYSDDPQTVFPRYCVSWMVSSGMPDFLEKLHVAALRAKNLEM
GIHDY
Download sequence
Identical sequences H2M0Q3
ENSORLP00000011979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]