SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012036 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012036
Domain Number 1 Region: 573-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.17e-56
Family Eukaryotic proteases 0.000033
Further Details:      
 
Domain Number 2 Region: 195-278
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-32
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 3 Region: 98-194
Classification Level Classification E-value
Superfamily Kringle-like 1.84e-31
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 4 Region: 284-369
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-30
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 5 Region: 484-570
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-23
Family Kringle modules 0.001
Further Details:      
 
Domain Number 6 Region: 19-108
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.37e-18
Family Hairpin loop containing domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012036   Gene: ENSORLG00000009601   Transcript: ENSORLT00000012037
Sequence length 813
Comment pep:known_by_projection chromosome:MEDAKA1:6:14826680:14840426:1 gene:ENSORLG00000009601 transcript:ENSORLT00000012037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEHKRMFLMLCLCASEGKRNALQDYQKSEGIQLTVAPGSAFLTKSRKLSISKCAKSCSRN
RRLPFACRAFHFDHINGKCQWLSFDRNAPGAQIYQNPNYELYQKKDYVRECILGTGQSYR
GRRSVTVNGILCQAWASPIPHEHKFMSKKFKKSDLRENYCRNPDNSTVGPWCFTTDPRPQ
LRHQECGIPQCSEVECINCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGL
DDNYCRNPNGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGKGEGYRGVVD
MTPTGLTCQRWDSQYPHNHSFIPEAYRCKDLRENYCRNPDGQDFPWCFTTDPRVRTMFCT
NIPQCGTQNRLANALSQSLSKGVVPKDCGNGFKRGFSGCFSETVCPKTENLNPHRVLKIP
KNYKNPYFFIFFCHNPVSINCHYAFEIYVGSYWLSFQKCCYQFYLRAEKSPTDQLDAHFQ
CLKEEKCYESLGENYRGQQSRTRSNLPCGPWREHSNRTNTTFVSTMTPHQSRLEGNYCRN
PDGDKHGPWCYTNNSAISWDYCSIKPYGLPSLGCFVHKTTRIVGGGPVGISEGSWMVSIH
KGSAHWCGGSLIRDEWVLTDRQCFSSCVPDLSEYRVWLGVSDIREGAFDLSKRQEVSIAH
VICGPNNSSLALLRLSKPALPAENVHTIQLPVAGCSIPEGTVCKMYGWGETKGTGHDDAL
KAVSLPIVSTNRCREMHKGNLHITNAKICAGGRKNEGVCERDYGGPLVCQDGDFRVIVGV
SVHGRGCARANQPSIFINVPFYTQWIYKVFKYY
Download sequence
Identical sequences H2M0V9
8090.ENSORLP00000012036 ENSORLP00000012036 ENSORLP00000012036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]