SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012044 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012044
Domain Number 1 Region: 4857-5071
Classification Level Classification E-value
Superfamily GFP-like 1.78e-60
Family Domain G2 of nidogen-1 0.00042
Further Details:      
 
Domain Number 2 Region: 4417-4514
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-24
Family I set domains 0.0077
Further Details:      
 
Domain Number 3 Region: 613-704
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-24
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 3695-3793
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 3136-3236
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-23
Family I set domains 0.0038
Further Details:      
 
Domain Number 6 Region: 2948-3047
Classification Level Classification E-value
Superfamily Immunoglobulin 2.47e-23
Family I set domains 0.0035
Further Details:      
 
Domain Number 7 Region: 3975-4068
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-23
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 3322-3422
Classification Level Classification E-value
Superfamily Immunoglobulin 4.42e-23
Family I set domains 0.0067
Further Details:      
 
Domain Number 9 Region: 4334-4433
Classification Level Classification E-value
Superfamily Immunoglobulin 7.28e-23
Family I set domains 0.0076
Further Details:      
 
Domain Number 10 Region: 2464-2561
Classification Level Classification E-value
Superfamily Immunoglobulin 8.13e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 4062-4158
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 3787-3886
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 13 Region: 1812-1911
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 14 Region: 2670-2756
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 15 Region: 2000-2096
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 16 Region: 3603-3702
Classification Level Classification E-value
Superfamily Immunoglobulin 5.97e-22
Family I set domains 0.0053
Further Details:      
 
Domain Number 17 Region: 4151-4249
Classification Level Classification E-value
Superfamily Immunoglobulin 7.47e-22
Family I set domains 0.0094
Further Details:      
 
Domain Number 18 Region: 3430-3517
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-21
Family I set domains 0.0073
Further Details:      
 
Domain Number 19 Region: 2381-2468
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-21
Family I set domains 0.024
Further Details:      
 
Domain Number 20 Region: 2181-2280
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 21 Region: 2777-2860
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-21
Family I set domains 0.033
Further Details:      
 
Domain Number 22 Region: 2092-2187
Classification Level Classification E-value
Superfamily Immunoglobulin 4.45e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 23 Region: 1534-1632
Classification Level Classification E-value
Superfamily Immunoglobulin 4.49e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 24 Region: 1082-1174
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 25 Region: 3232-3330
Classification Level Classification E-value
Superfamily Immunoglobulin 6.11e-21
Family I set domains 0.0041
Further Details:      
 
Domain Number 26 Region: 2854-2955
Classification Level Classification E-value
Superfamily Immunoglobulin 7.4e-21
Family I set domains 0.0078
Further Details:      
 
Domain Number 27 Region: 1164-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 7.45e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 28 Region: 2571-2657
Classification Level Classification E-value
Superfamily Immunoglobulin 8.23e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 29 Region: 3040-3142
Classification Level Classification E-value
Superfamily Immunoglobulin 9e-21
Family I set domains 0.0079
Further Details:      
 
Domain Number 30 Region: 694-788
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-20
Family I set domains 0.034
Further Details:      
 
Domain Number 31 Region: 1437-1538
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 1719-1818
Classification Level Classification E-value
Superfamily Immunoglobulin 2.96e-20
Family I set domains 0.0068
Further Details:      
 
Domain Number 33 Region: 43-219
Classification Level Classification E-value
Superfamily vWA-like 3.11e-20
Family Integrin A (or I) domain 0.04
Further Details:      
 
Domain Number 34 Region: 2288-2375
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 35 Region: 3874-3975
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-19
Family I set domains 0.038
Further Details:      
 
Domain Number 36 Region: 3512-3610
Classification Level Classification E-value
Superfamily Immunoglobulin 2.26e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 37 Region: 785-883
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-19
Family I set domains 0.0053
Further Details:      
 
Domain Number 38 Region: 1359-1444
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-19
Family I set domains 0.026
Further Details:      
 
Domain Number 39 Region: 1624-1724
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 40 Region: 520-616
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-18
Family I set domains 0.046
Further Details:      
 
Domain Number 41 Region: 4243-4337
Classification Level Classification E-value
Superfamily Immunoglobulin 3.96e-18
Family I set domains 0.0095
Further Details:      
 
Domain Number 42 Region: 1907-2004
Classification Level Classification E-value
Superfamily Immunoglobulin 3.97e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 43 Region: 886-982
Classification Level Classification E-value
Superfamily Immunoglobulin 8.52e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 44 Region: 1256-1350
Classification Level Classification E-value
Superfamily Immunoglobulin 1.46e-17
Family I set domains 0.0063
Further Details:      
 
Domain Number 45 Region: 970-1070
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 46 Region: 4569-4627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000017
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 47 Region: 4684-4741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000128
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 48 Region: 4798-4855
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000314
Family TSP-1 type 1 repeat 0.00016
Further Details:      
 
Domain Number 49 Region: 4514-4570
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000484
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 50 Region: 4630-4679
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 51 Region: 5220-5340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 52 Region: 4740-4798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 53 Region: 5405-5516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000565
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 54 Region: 5077-5182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 55 Region: 450-523
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000136
Family I set domains 0.035
Further Details:      
 
Domain Number 56 Region: 5181-5236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012044   Gene: ENSORLG00000009600   Transcript: ENSORLT00000012045
Sequence length 5624
Comment pep:known_by_projection chromosome:MEDAKA1:4:16026325:16112437:-1 gene:ENSORLG00000009600 transcript:ENSORLT00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFGSDMGRALLLVALALSAALCAGQDTGAPVRNEDIPEGASTLAFVFDVTGSMYDDLVQV
IEGASKILETSLSRPKRPLYNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCP
EMSIGAIKIALEISLPGSFIYVFTDARSKDFKLTQEVLQLIQQKQSQVVFVLTGDCDDRT
HIGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQSSKVHLLSTDHFSQVSNTWQLP
FDPSLKEVTVALSGPAPDIEILNPLGKVVGQKDGLTELLHIPNSAKVVNIKEPQAGMWSV
KTSSEGRHSVRISGLSNIDFRAGFSRKPTLDFKMTSSRPVQGIPTHVLMNTTGLSPPARP
DRLELLTVTGEVIKTLPIRYYPERLPYSLWNITEFVPPNQAFFLRVTGYDRNGFLFQRVS
SVSFSSIIPNAPTVLMPATTIGYYLQRGSVVCHVESLIPFTLRFSRDGKRLGEDQLFSES
DSASWEIDQVTLKDEDYYECIAISTAGTGRARTFLDVSEPPPAITVEGNMTASPGARVLL
TCHVVSTVSFNFTWLRGGREARLDPRMNMLGNLSLQVFPVTPEDSGWYSCIATNEGGATA
ERMFLTVEDVPRVSVEPQNQTFMVGDDVRIQCSASGYPSPRLVWTHNDMFIVASSRHRMT
NDGALIIRNSERKDGGVYRCLASNQAGTDTASSILTYVEPPVVTVALSEILIGIGETTLM
ACSASGVPLPEIKWYKGGVQLYSSSVLEVDLLGGTLTIKQTQPGDAGDYTCVAVNAVGSS
SGTISLDVGAAPKFAQELSDVASDISSNVTLQCRAEGHPEPQITWRRADGYSLFNRPRLH
GSILQKKGDLHIINLWVDDEAEYICEAQNQFGRIQTQATITVTGLVPPVIAASPAVINVM
DGQQLTLPCVLLAGNPLPERQWLHNYGLVTSDQYVTVRMDGSLHIERVGLGDEGDYICLA
ENVVGSANHTTAVNIHVIPTIQHGPQVFSTIEGIPISLPCRANGVPRPDVAWTKGKKRLN
VGGPSFSLDPDGNLLINSPSGNETGEFTCTASNAAGSASRKVQLTVYVRPRSSSDGTRDS
SQPVKISVIEGEDALLPCDVRSVPPPTISWAKGKQLISPFSPRHIQLSSGSMKILETRVS
DSGFYVCVASNIAGNLTLSTELSVIVPPRIQPGPKVMKVQVGHTVELPCVPKGVPEPTVT
WTKDLKEYQASPDGSLVLKTVTLEDEGTYMCTASNMAGRDEARIRVVIQVPPVVEVLEPP
FNSPLQERVANQRIAFPCPAKGLPKPVIRWLRNGQELTGNEPGVSILEDGTLLILASVSP
LDNGEYVCTAANDAGSTEKKYQLKVNVPPDLRDRDIQGNLSVIVNQPISLMCDVIGSPTP
VITWYRDGAPVVSGSNIQILDMGKTLKVLKAIKADAGSYSCKAINIAGSTEKDFLLDVMV
PPKIDGSDSPKTVSVNVKEEITLECNVQGSPFPIIQWFKNRKLMFLGDSNLEVTNRGQVL
RIKSARLGDQALYQCSVSNPAGKQSKDFNLIVYVPPSIKGGNLTTEVTALQDTTVNLECE
ARGVPLPTITWYRKGTAVLSNRQTQYVERGHFLKIPRVQATDAGQYTCKVTSVAGSAEKN
YELEVYVPPTIVRGDDGPTEKKVIVAKSLILECEVAGHPPPSITWLKDGVPVRDGESVRV
FEQGKKVEIVSASTSDSGSYVCVATSIAGDKEVKYDVRVLVPPFIDGADDVTGRTVLINS
PVELECESTGTPAPVITWFKNGKPLRQSQGLRIVASARRLVVSRAQVTDTAHFQCVATNE
AGNHQRDFNVVVQVPPSIRMPGPAERSVILNQTISLECISAGIPPPSITWIKDGQPVDTT
KEHLKLQSVGRTFTISEARQEDSGKYTCLATNAAGEVQQHIRLSVHEPPRILFSEETINQ
TILSGFPIEFECKATGSPLPAVSWSKDGRPLTSVTGVSVLKRGQVLKIERAQLLDAGVYK
CLAVNLAGAAELLYSLQVFVPPTISSRGSTVAVVVNEAAKLECEASGVPLPSLTWLKDGS
PVAIVSHRTQVLSAGRVLSLSSAQISDTGTYTCVAINPGGEQQREYELKVYVPPNIKGEE
VNSTVMLGQSVELLCQSDAIPPPTLSWRKDGRPLFRKPGLIVADHGSRLKINSAQVQDSG
RYTCEATNVAGKTEKNYNLDVWVSPSIRGSGEVSHLTVIEGNLISLVCELSGIPPPSLTW
KKDGFELKSDQRLRILSGGRQLQISSAQKADTAAYTCLASSAAGATSKEYNLQVYVRPSI
RRGEGETDDITVIKGGNITLDCAAEGVPKPAVSWLKDGRPITGQHGAKVLNDGRLLQIRD
ADVTDTGRYTCVSVNVVGQADSKYDVSVHVPPSILGQVHSPENISVVVKNPVALTCEASG
IPLPTISWLKDNQPIQTSSSVLILSGGRSVRLMHTAVTDAGRYTCIVSNSGGEERKNFDL
VILVPPRVVAEGTVVDTKVKEKRNITLTCEASGNPVPEIKWLKDGLLLVPDRHHQILSHG
RFLQISEAQVADTGRYSCLASNSAGDRSRHYNLNVLVSPTIAGNSPDFSAEEVIVTLSSP
TSLVCEVQSYPPALITWLKDGIQFESTRNVRVLPGGRTLQILNAKVENAGRYTCVATNEA
GETLKHYEVKVYVPPQINKNDISGHELSSKEVKVTINSTLTLECVAQAFPSPTLQWYKDG
QILRADDHVSVTANGRIVQIKHAQVSDTGRYTCVATNVAGEDEMDFDVNIQVPPNFNKPG
GAGGSTSLPAFGGDSRDVILNNPFSLYCETNAVPPPMLTWYKDGRLLTSNDKVLIFPGGR
VLQIPRARLEDSGRYTCVAINEAGQDSIQYDVRVLLPPVIREKDSDVPDEVTVLINQTAQ
LDCHVDGNPTPKVTWFKDSQLISSEGPYRVLSSGRTLQVVSALVPNTGRYVCVPENVAGS
SKKQFNLNVHVPPSIFGVSLENVTAVVNNFVSLSCEVTGFPPPTLSWLSDRGPIQASSNT
LIMPGGRTLQILKPKVSDGGKYTCVAMNAAGEAYKHIHLTVFVPPSIRGNSGDAPVVVNA
LVGKSITLQCESNAVPPPNIIWYKNGRVLTESANLQILAEGQILKIKTSEVSDTGQYVCI
ATNVAGQVDKNFHLNIHVPPRIDGSVRESLVEIISNSVSFACDASGIPPPNLSWLKNGQP
IENSESLEMHISSGGSKLQIARLQLSDGGTYTCVASNVEGKARKSYHLTIQVPPSITGSD
MPSEMGVLLNESIQMVCQAQGAPVPTIQWLKDGKAVNLVSILRVSPDGSRLTVVRAHPDD
SGKYTCVATNAAGEEDRIFNLNVYVPPVIVGNSGAPEHQTAVLDSSVSIQCVAAGTPLPH
LNWLKNGLPLPVSSHVRLLSAGQVLRIMRIQVSDGGKYTCVASNRAGVDNKHYNLQVHVP
PGLDGAGSTEDVTVIRGNTASLLCVADGTPVPTISWLREDVPVLSEHNIRLLNLNTTLQI
SLAQVNDTGHYTCKVYNTAGEASRHFNLKVLEPPQITGSGDPVEVSVLVNNVLELECEAS
GIPTPFLTWLKDGRPLPQTDSLRLLRGGEVLRMASAQLEDTGRYSCLANSPAGDDDKEFL
VQVHVPPNIVGENTPQDVSVLQNRQATLECKSDAVPPPTLTWLKDGQQLQASARVRILSG
GRYLQINLSELSDTAQYTCVASNVAGKTTREFNLNVNVAPTIKDGPQIVTVHVDKSAVLE
CVVNGVPPPRVTWRKNGAILGGNNPRYTFEENGSLHIHSAQVSDTGRYLCLVTNPAGTQR
RRVDMQVYLPPSIANSQTNVTVIVNVQTTLPCEASGIPKPTVSWQKKGRTISTDQNQNMY
RLLSSGSLVILAPTVEDTAVYTCVVSNEAGNNSKSIRLTVIVPPSIADEPAELVVLRQSP
VVISCTAYGVPKPSIHWSKDGMKLPNKGQGYNILPTGAVEISSAELSHAGRYSCTAKNIA
GSTQRHVPLTVHELPVIQSHPSSLDVIFNTPITLPCKATGSPRPTITWQKEGINIPTTAG
GLTILPDGSLQITRTTLSDSGTYICVAQNPAGTAMGKTKLRVQVPPVIRSEIQEYQAPVD
SAMMLHCHAEGTPPPSVTWHKDGQLLSDSVRQRLLSSGSLQITLIQPTDSGRYTCTAANA
AGTATLDMSLTVQIPPSIRGGEQEVVVVESSHAQLMCVAEGIPQPSLSWEKDGNPLSEKG
GEYTILPSGELVIDSAQPGDAGSYTCFATNAVGQDSWTVKLSVHTHPVFVELLGDMALNR
GERLLLACGASGIPQPKITWTFNNNIIPAHYDQTNGRSELLVERVSKGDTGTYTCVAENS
VGTIKSLGFVHVKEPPIIDGDLHSNRVEPLGGNTILNCEVRGDPPPTIQWSKNGVNIQIG
NRIRQMFNGSLAIYGTVSEDAGIYMCVATNDAGVVERSITLTLQSAPTITVEPVGTVVNA
GTTVVLSCQAEGEPTPMIEWSRQGRPLQGEDRFSTLFNGSLRISNAQKEDTAEYECVARN
LLGSVLVRVTLTVRVHGGYSEWSEWGSCSVSCGAGIQKRLRQCNNPLPANGGHHCAGSDT
EKSSCQGNPCPVDGNWSEWSVWEECSQTCGQGNRTRFRTCSNPLPQYGGKPCEGKAVEVI
MCSVRPCPVAGNWGSWLPWGPCSETCGRGMQSRIRLCNNPPPQFDGSQCEGTDTQSKMCL
ERLCPVHGKWSSWMNWGPCSVSCGGGTRQRTRLCASPAPQHGGRSCEGNGVHMDFCNTDP
CPISGNWGTWSSWGSCSKTCNGGQMRRYRTCDSPRPAFGGRACAGADEQMQRCSIVSCPV
DGNWGSWQPWGQCSVSCGGGERTRLRLCNNPAPSYGGRQCPGDSSLLSRCNTQACPGGPQ
KARGTIRGNINDIEFGIAILNATISDSSSGSRVIKASISNVPRELGPAMRKLVSLLNAVY
WTTAHEAGEAVNGYTLTGGVFKRETQVEFATGEILRMTHIARGLDSDGVLLIDIVVNGHT
LQLPSQADIHFKDYTEDYIQTGPGQLYALSTRIFSINNESVPYSWNHTIFYDPSKGKMPY
LVEMLHATSISALYHPLEEVLEYRIQAKITKGDRSNQCPNGFILVSSGLYCADENECDVG
NPCSHTCHNVMGTYYCSCPQGLSISADGKTCQDIDECSLSGHVCHDGQDCENTVGSYRCL
MRCGRGFRRTTDGLNCMDVNECQESNPCNQRCFNTIGGYRCSCEPGFQLRNRRCIDINEC
RQRVCRSDQLCKNTRGSYTCIDLCPSGMTKGANGTCADVDECREGTHQCSYNQICENTRG
SYHCSCPRGYRSQGMGRPCIDINECERLPQPCAHQCINTPGSYTCICPPGRHLLGDGKSC
AGLERLPSYESYSYIYSSSQSSPEGSSSPRLYHNLASQSFHSFTANTVRGFRRRSRREAS
KLQVTLVCQRGFESRGGLCLDINECEMRDTCQHECMNTPGSHRCLCPAGYRLMMNGKTCQ
DVDECLEQNIQCGMNRMCFNMRGSYECIDTPCPPNYQRDPATGFCLKNCPPNDLECTLSH
YALEYKLLSLPFGIASNQDLIRLVAYTQDGVMHTRTTFSVVDQDLTLPFALRDENHKGVL
FTTRPLREPHTYRMKVRALSFSEDGGIEYRTTFIVYIAVSAYPY
Download sequence
Identical sequences H2M0W7
8090.ENSORLP00000012044 ENSORLP00000012048 ENSORLP00000012044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]