SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012302 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012302
Domain Number 1 Region: 543-588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 88-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000132
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 34-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012302
Domain Number - Region: 491-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000425
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012302   Gene: ENSORLG00000009804   Transcript: ENSORLT00000012303
Sequence length 588
Comment pep:known_by_projection chromosome:MEDAKA1:17:15926038:15934728:1 gene:ENSORLG00000009804 transcript:ENSORLT00000012303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVNASWRPSTSTSNSWKWNSLRGTRSVSKPAPINCQLGSWSMWTSCNQCTDKKFRFRHL
ERPSQFGGDECVGMLWERLVCPQATSQCLVNDYCEESFTCKETGNSGRCISQSLRCNGES
DCYDFSDEDECQDVNLRRDKCATIMPIPGAERGTQGYNILTGDFVDQVFDPAYFGGQCEY
VYNGEWRKFTYDAFCESLHYKEDEKNYRKPYNYHAYRFVAEATSEGSHEYYEDMQSLLKA
RKTLSSFNAGVTVGVYYVEAGLKGSQESEFLTNITKYNSMEFGFIRVWAKVQTALFKMRS
NQLMLHEDLYVSLMELPESYEFGMYAKFLNTFGTHYVTEGTMGGSLEYIFIVNKTAMAQS
NVESHRFEQCIGASLGFSYPVTDSVKFGGKISGQGCGDTTNLSKKDGASSSVIEDVVTFV
KGGITQTSAGVLVIRDADTYRKWGASLKYNPALIEYETMPIYEAVRLSTAADHVGPRVAN
LQKAFDEYLQQFDACRCAPCKHNGVPVLSGTSCSCLCKSGYRGLSCEETLRGALIDSTDT
RTDGSWSCWGSWSSCSSRRKSRTRTCNNPAPERGGATCLGSSSQTQNC
Download sequence
Identical sequences H2M1L8
ENSORLP00000012304 ENSORLP00000012302 8090.ENSORLP00000012302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]