SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012304 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012304
Domain Number 1 Region: 507-552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 63-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000515
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 9-56
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012304
Domain Number - Region: 453-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000533
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012304   Gene: ENSORLG00000009804   Transcript: ENSORLT00000012305
Sequence length 552
Comment pep:known_by_projection chromosome:MEDAKA1:17:15926266:15934731:1 gene:ENSORLG00000009804 transcript:ENSORLT00000012305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSVSKPAPINCQLGSWSMWTSCNQCTDKKFRFRHLERPSQFGGDECVGMLWERLVCPQAT
SQCLVNDYCEESFTCKETGRCISQSLRCNGESDCYDFSDEDECQDVNVTAEPIRLILQTN
CAFCGKSTKFESYNILTGDFVDQVFDPAYFGGQCEYVYNGEWRKFTKPYNYHAYRFVAEA
TSEGSHEYYEDMQSLLKARKTLSSFNAGVTVGVYYVEAGLKGSQESEFLTNITKYNSMFC
LQEFGFIRVWAKVQTALFKMRSNQLMLHEDLYVSLMELPESYEFGMYAKFLNTFGTHYVT
EGTMGGSLEYIFIVNKTAMAQSNVESHRFEQCIGASLGFSYPVTDSVKFGGKISGQGCGD
TTNLSKKDGASSSVIEDVVTFVKGGITQTSAGVLVIRDADTYRKWGASLKYNPALIEYET
MPIYEAVRLSTAADHVGPRVANLQKAFDEYLQQFDACRCAPCKHNGVPVLSGTSCSCLCK
SGYRGLSCEETLRGANSRILSAPSWTDGSWSCWGSWSSCSSRRKSRTRTCNNPAPERGGA
TCLGSSSQTQNC
Download sequence
Identical sequences H2M1M0
ENSORLP00000012304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]