SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012324 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012324
Domain Number 1 Region: 141-194
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000157
Family Frizzled cysteine-rich domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012324   Gene: ENSORLG00000009822   Transcript: ENSORLT00000012325
Sequence length 240
Comment pep:known_by_projection chromosome:MEDAKA1:10:23239577:23240296:-1 gene:ENSORLG00000009822 transcript:ENSORLT00000012325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCSSFALVLEAFDLVLRHGRNSTLAMLKSEFPGLGSGAQGSVVQLFRDMSLYTLGSDST
VDNMVTVFLGKLFPLTHHRLLGGNVASVKEECLRGAWKDSGAFGPYPKLIMTRLSRSLLA
TRVFLQALNLGIEVVNTTHHLRPSRDCSRALLRLWYCPHCQGVLGPPPCRGFCQAVMQSC
LGGAAEVQPHWRRYIEGLGKLAGGMRGEQDMEAVVLRLPSMIKLALKHAVSTRSHLSTLV
Download sequence
Identical sequences H2M1P0
ENSORLP00000012324 8090.ENSORLP00000012324 ENSORLP00000012324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]