SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012416 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012416
Domain Number 1 Region: 4-406
Classification Level Classification E-value
Superfamily Sema domain 4.19e-127
Family Sema domain 0.000000171
Further Details:      
 
Domain Number 2 Region: 781-833
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000235
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 512-562
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000353
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 725-779
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 402-452
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000279
Family Plexin repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 572-614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 836-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000628
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012416
Domain Number - Region: 456-509
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00471
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012416   Gene: ENSORLG00000009896   Transcript: ENSORLT00000012417
Sequence length 1025
Comment pep:known_by_projection chromosome:MEDAKA1:21:6413483:6488231:1 gene:ENSORLG00000009896 transcript:ENSORLT00000012417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLLQATEWAPDEETRRSCQSKGKTEIECQNYIRVLLLNKTEVMTCGTNAFQPLCITREV
GNMSRVLERVNGVARCPYDPRHNSTSVVTESGELYAATVIDFSGRDPVIYRSLGGMPPLR
TAQYNSKWLNEPHFISAYEIGLFTFFFLRENAVEHDCGKTVYSRVARVCKNDIGGRFLLE
DTWTTFMKARLNCSRSGEIPFYYNELQSTFYLPEQDLIYGIFTTNVNSIAASAVCAFNLS
AITQAFNGPFRSQENPRSTWLPTPNPIRDFQCGTISDHGPNEGLTERSLQDAQRLYLMND
VVQPESVDPLVMQDDVRFSNLVVDIVQGMDTLYHVMYISTEYGTILKALATPNKNLQGCY
LEEMELLPPGVQEPILSLQILHSDRSLFVGLSDRVMKIPLERCGTYKTESMCLEARDPYC
GWDFRKRRCTTLEDSSNMSQWKQNITICPLRNQTTNGGFGPWAQWQPCNNDDPVDGVSSC
LCRSRSCDSPLPRCGGKNCVGTTIEVSNCSRNGGWTPWSSWGQCSTTCGTGFELRQRSCN
NPSPRHGGRVCVGPSRDERFCNEGVPCPQPIFWTPWSSWTKCSTACGGGVHSRVRTCENG
NSCPGCALVGHTLKKKSSQTEKNRENKQRKCESKEYKACNLEACPEVKRNTPWTPWMPFN
VTQSGARHEQRTRYMCRAHLSDPHELQIGRRKTETRICKHDGTAACETDSLVEELLKIPV
VRVAGLGWSSWETWSSCSQSCSKGYRTRRRTCTGPEGKSAPVACRGSPVEYQDCNVQACP
VNGAWSCWSPWSQCSVGCGGGHYQRTRSCNSPTPASGGDICIGLHTEEALCNTHTCDGGW
MTWSQWSACDDSGLQMRSRVCGSQSSIPCVGNSTQRRDCNEIPVILPASGFDKDQQCGAF
TSIQLITTGVSCFLGAGLLSFLIYVYCQRFHKPSQESAVIHPTTPNHLNYKGNTTPKNEK
YTPMEFKTLNKNNLNPDERSNLYPTPLQQTNVYTTTYYPTTLGKFDYQPNSSPSPCRTYN
NSNNS
Download sequence
Identical sequences H2M1Y1
ENSORLP00000012416 8090.ENSORLP00000012416 ENSORLP00000012416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]