SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012643 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012643
Domain Number 1 Region: 23-467
Classification Level Classification E-value
Superfamily Sema domain 7.72e-117
Family Sema domain 0.0000626
Further Details:      
 
Domain Number 2 Region: 1579-1706,1891-2077
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-47
Family p120GAP domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 1059-1155
Classification Level Classification E-value
Superfamily E set domains 4.62e-19
Family Other IPT/TIG domains 0.0045
Further Details:      
 
Domain Number 4 Region: 1152-1244
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000021
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 470-521
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000562
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1241-1353
Classification Level Classification E-value
Superfamily E set domains 0.0000000252
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012643
Domain Number - Region: 1365-1420
Classification Level Classification E-value
Superfamily E set domains 0.0007
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number - Region: 624-656
Classification Level Classification E-value
Superfamily Plexin repeat 0.00209
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012643   Gene: ENSORLG00000010071   Transcript: ENSORLT00000012644
Sequence length 2110
Comment pep:known_by_projection chromosome:MEDAKA1:5:18506799:18536438:1 gene:ENSORLG00000010071 transcript:ENSORLT00000012644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKILGPHGGTVVSPLAQIPTGFKWNNTLFEHLALHPDPTMGWIYIGARDHLFQLDQFLQL
HVQDKTGPMIDSRECLPPVTETNCPQAKETSNHNKLLLVDPYSMELITCGSVNQGICQKR
NLDSVNKVLFSTERPVDTQYVAANHPNVSTVGLVVRSRPDRQAVLFVGRGYTSSHPPIST
RNLAQEPIFSYEETAKLAVAGRLSEYDHHFVASFAHHQHIYFLFYRRDLKSQSREYRTYI
SRICLDDQAYYSYVEVPLTCRSRTGKMYNLLQAVQLGLSSDGSQGSGSEILLGVFSTPTS
SASPNEDSALCMFHLEDVDQRIDSTRDLCYTKMGREEGDEAAYIEYEVKSNCANLPENTL
KAYPCGSDHTPSPMASRVAVEVETILDSPSAQLTAVAVSVRPGHTIAFLGDSKGNLHKVF
LGPHGEVEEYSVTSVQKNAAISSDLILDQSEEHLFIMTHSMLQKRPVAECQQNPDCNSCL
QAHDPYCGWCVLEARCTLQSQCSRGGQPGQWLWSFDMEQHCLYISDLNPSNVSREESRPV
FLSVPGLPVLDKGESYSCFFRDVRSPAVLTDRGISCRSPDSSRIPSVPQRQDFVVVTLSL
RFGDVVVAAKDFTFFDCTAVKQLSGSQPCHRCVLSRWGCNWCVHQHSCTHKSVCGEGVII
YNQHFRLLHVLPPKKTLSRLFVLFTTYCFLSPCSPPPPLCFHQFKLPTSPPPTAKPAKVI
TTGPVTTATSPPVPTTAFIPELTTLPPPLPPGRSSLPPPVTAAPPSVITGGSVVVADELV
VVTQSSPADTPGVVMVTTEVARPSDGLSGDVDPTTMPGATSTSLPMTTRSVEEAPLTPSP
PEPAGPAENDTFLAPTVLSGDGEVDPGLPSYPQPVDLEAELELDYQNDPDDTFLPGDEGS
FISWGSSACPCVEKVLGSSLLPVHVEKKITLLARNLHLYQDTMLEYECVLIIEGQTVVVD
AFVEADYVNPSSFFITCQQHKLTYSAPVEEYKAMVYVKRRNTFHVDSSPDLYVTLYSCSV
GRSDCSRCRTADPKYSCVWCGGAQPSCLYSKSCSAAAETCPAPVIHSFEPLSGLLEGGTL
VTISGSNLGQKPTDVLDSVLVAGEPCTVIPELYQVSSRIVCRTKPSQGEKVGYVSVWVNG
GERSLSSQTFSYQDPSVMGVTPERGPKAGGISLTITGRNLRTGLPSDLTVTVGGVPCEII
SEIQSSSVVCRTGSSNTTGEHRVTLHYGSHQRHLHSSSYRYTPNPNVTRAAPAKSFIDGG
RLIIVHGQNLDVVQEPHMVVSYPVSQTQRRQKRRLTSSQFTERCKVNSSSLMLCYSPAVD
ESILRSKFRVEFLLDSLRFDFNALSPQPFSYQPSPVLQPLNQQNPLKAYRYNPGSFIQLE
GDNLDLGISKEEVVVLIGDVVCAVKTLTRNHLYCEPPPQQLRPGPNCKKCEVFDQLPEFT
VQMGNKNFSLGKVQYDTLSLATFPLEAQIGVGVGASIVALIVLIIVLIYRRKSKQALRDY
KKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFFPGHRE
SPLRRELDIQESRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLT
VALHEKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFLRDS
AGEGLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYKTLTLNVLVQGGGVNE
TQPVPSKVLDCDTITQVKEKLLEQVYKGTSFSHRPHVDSLDLEWRSGVAGHLILSDEDLT
SVIQGSWKRLNTLQHYKVPDGATVALVPRHTKNLHHDNHDYIAGEKTPMLEDADEGGVRL
WHLVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDLFMVILSTSR
PVPLAVKYFFDLLDDQAGQHGITDPETIHIWKTNSLPLRFWINIIKNPQFIFDVQASDHV
DAVLSVIAQTFMDSCTIAEHKLGRDSPINKLLYARDIPRYKQMVERFYADIRQTISASDQ
EMNSALAELSRNHSGGLNYKVALHELYKYINKYYDQIITALEEDPMAQKMQLGLRLQQIA
AAVENKVTDL
Download sequence
Identical sequences H2M2J8
8090.ENSORLP00000012643 ENSORLP00000012643 ENSORLP00000012643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]