SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012786 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012786
Domain Number 1 Region: 426-708
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.09e-73
Family Protein kinases, catalytic subunit 0.000000364
Further Details:      
 
Domain Number 2 Region: 266-353
Classification Level Classification E-value
Superfamily Kringle-like 1.72e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 13-111
Classification Level Classification E-value
Superfamily Immunoglobulin 4.09e-22
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012786
Domain Number - Region: 157-239
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00157
Family Frizzled cysteine-rich domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012786   Gene: ENSORLG00000010196   Transcript: ENSORLT00000012787
Sequence length 911
Comment pep:known_by_projection chromosome:MEDAKA1:4:16999113:17109125:-1 gene:ENSORLG00000010196 transcript:ENSORLT00000012787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAATSLNKTGSPFIRIDAPMNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPR
RVSIRSMPYGSRLRIRNLDTTDTGYFQCMASNSKGSVSTTGVLFVKFDPHPTPLPGRPMD
DFDEDGFCQPYRGIACARFIGNRSIFVDSLQMQGEIETQITAAFTMIGTSNQLSDRCSQF
AIPSLCHFAFPTCDRSSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNC
EELAASDSPEAANCLRIGIPMPEPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYP
HSHTYLAVRYPELNGGHSYCRNPGNKHEAPWCFTLDEGVRMELCDISICDHNEKASGNME
ILYILVPSVAIPLAIALLFFFICVCRNNQMSARPPAPRQPKLVRGQNLEISVLNTAYKSK
GKAKELPLSAVRFMEELGECNFGKIYKGHLYLPGMDQAQLVAIKTLKDVSNTKQWADFQQ
ESAVLAELQHPNVVCLLGVVTQEHPVCMLFEFLPQGDLHEFLIMRSPHSDVGCSSDEDGT
VKSSLDHGDFLHIAIQVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYS
SDYYCIQPKTLLPIRWMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVM
EMVRKRQLLPCPEDCPPRFYGLMTECWQEGPARRPRFKDIHTRLRAWEGLSSHASSSTPS
GGGGNATTQTTSLSASPVSNLSNPRYAAATAAGYLYPAQAIPAPGQMAPITAWTPMAVPQ
THQRFIPVNGYPIPPGYTAFPAHFAPQAPPTRVIQHHLPPPKSRSPSSASGSTSTGHVSG
VHSTTGSAHEANTPLLSHCIMPGSSGGQAQVYGQVSQKGAAQLDHMSQTSALLSPDSDIM
MYNDSVITADL
Download sequence
Identical sequences H2M2Y8
ENSORLP00000012786 ENSORLP00000012786 8090.ENSORLP00000012786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]